Quantcast
YY
comment(s)
169 views this wk.
YY

Yuval Yairi

Israeli photographer
The basics
About
Occupation Photographer
Date of birth
Authority VIAF id
The details
Biography

Yuval Yairi (Hebrew: יובל יאירי‎‎; born 1961 in Tel-Aviv, Israel) is an Israeli artist, using photography and video. Exhibited at the Tel Aviv Museum of Art, the Israel Museum, Andrea Meislin Gallery NYC,Zemck Gallery Tel Aviv, Alon Segev Gallery Tel Aviv, Qbox Gallery Athens, Zuiderkerk Amsterdam, San Diego Natural History Museum]

Yuval Yairi's series "Forevemore" has been exhibited at the Tel Aviv Museum of Art and Andrea Meislin Gallery in NYC in 2005.

Yairi photographs the leper house with a digital video camera in still mode, constructing the image from hundreds (at times thousands) of frames. The pictures are taken in the course of several hours, during which the artist slowly and accurately documents every detail in the space from a single position, like the viewer's observation movement upon entering the space. He selects details which he then combines into a final unified photographic image containing a wealth of information, one that no single still photograph can contain. Thus, in fact, Yairi overcomes the temporal and spatial limitations of conventional photography.

from exhibition text, Tel Aviv Museum.
Yuval Yairi's "Palaces of Memory" series has been exhibited at Alon Segev Gallery in 2007, and in New York at Andrea Meislin Gallery, 2008.

The Cage and the Bird "A cage went in search of a bird" wrote Kafka : a photographic structure went out into the world in search of motifs that would suit it. The result is the heart of this exhibition. The world can be perceived as "at once," as one, absolute, indivisible thing. But it can also be thought of as the sum of an infinite numbers of parts. So it is with everything, small or large: the world exists both as "one" (the absolute) and as a cumulation of an infinity of units. It is this duality that Yuval Yairi's photographs attempt to capture. They are almost all, at one and the same time, a collection of fractions, and a whole. They represent these two states of being - like water attempting to be vapor and ice at one and the same time. The "thickening of time" results from the image of the "art of memory," from which Yairi sets out to make his recent series of photographs, following in the path of Simonides of Ceos (556-468 B.C.E), the Greek poet considered to be the father of mnemonics (the art of aiding memory). Simonides' method of remembering is based on the "translation" of abstract concepts into concrete objects and their imaginary placement in a space well known to the memorizer, based on the assumption that concrete images are easier to remember than abstract ideas. Thus, for example, a poem can be translated into a series of mnemonic images that can be installed in the home of the memorizer. The act of remembering involves a stroll through the house, and the gathering of visual "reminders" along a known path.

Dror Burstein

Exhibitions

  • 2014 “The Benevolent Tree”, Group Exhibition, The Umm el-Fahem Art Gallery
  • 2014 Video art and experimental film festival, Tribeca Cinemas, NY
  • 2014 Festival of Migrant Films, Ljubljana, Slovenia
  • 2014 Aiva, international video art festival, Finspång, Sweden
  • 2014 “Fokus 2014 video art festival”, Nikolaj Kunsthal, Copenhagen
  • 2013 Yuval Yairi: LAND, solo exhibition, Zemack Gallery, Tel Aviv
  • 2011 Life: A User's Manual, group exhibition, The Israel Museum, Jerusalem
  • 2011 Purity & Danger, group exhibition, Zemack Contemporary, Tel Aviv
  • 2011 Yuval Yairi: WORK, solo exhibition, Zemack Gallery, Tel Aviv
  • 2011 New in Photography - Recent Acquisitions, The Israel Museum, Jerusalem
  • 2010 The Four Seasons, group exhibition, The Israel Museum, Jerusalem
  • 2010 Roundabout, group exhibition, City Gallery, Wellington, New Zealand
  • 2010 Looking In, Looking Out: The Window in Art, group exhibition, Israel Museum, Jerusalem
  • 2010 Now we are six, group exhibition, Andrea Meislin Gallery, NY
  • 2009 Soul Searching, group exhibition, High Touch Gallery, Herzliya
  • 2009 Between the private and the public domain, group exhibition, Agnon House, Jerusalem
  • 2008 Jerusalem, Surface Fractures, group exhibition, The Jerusalem Artist's House, Jerusalem
  • 2008 Inside Israel, group exhibition, 3 Gorges Museum, Chongqing, China
  • 2008 Palaces of Memory, solo exhibition, Andrea Meislin Gallery, NY
  • 2008 British Council - Living Together, regional group exhibition
  • 2008 @60.art.Israel.world, group exhibition, Magnes Museum, Berkeley, Ca, USA
  • 2008 The homes of others, group exhibition, Ticho House, The Israel Museum, Jerusalem
  • 2007 Contemporary Israeli Photography, group exhibition, San Diego Natural History Museum
  • 2007 Moods and Modes in Israeli Photography, group exhibition, Tel Aviv Museum of Art
  • 2007 Palaces of Memory, solo exhibition, Alon Segev Gallery, Tel Aviv
  • 2007 Art for Aid, group exhibition, Zuiderkerk, Amsterdam
  • 2007 Current Visions part 2, group exhibition, Andrea Meislin Gallery, NY
  • 2006 Lanterna Magica, Metaphysical Light in Israeli Photography, Bat-Yam Museum of Art
  • 2006 d.t-minimum time, Qbox Gallery, Athens, Greece
  • 2006 Heara 10, Science Museum, Jerusalem (4 min. video with Anat Barel)
  • 2005 Yuval Yairi: Forevermore, solo exhibition, Tel Aviv Museum of Art
  • 2005 Forevermore: The Hansen Project, solo exhibition, Andrea Meislin Gallery, New York
  • 2004 "New Exposures" Recent acquisitions in Photography, The Israel Museum, Jerusalem
  • 2004 Outside In, Sotheby's, London (with artist Marc Cohen, NY)
  • 2003 The Valley Train, Gafen, Jerusalem
  • 2002 Group exhibition, Popolus Gallery, Tel-Aviv
The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Yuval Yairi?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-downpandoragplaydeezerihearttuneinpandoragplaydeezerihearttuneinitunes