Quantcast
TH
comment(s)
72 views this wk.
TH

Tina Hirsch

American film editor
The basics
About
Occupation Film editor
Country United States of America
Date of birth New York
Authority IMDB id ISNI id VIAF id Library of congress id
The details
Biography

Tina Hirsch (born 1943) also known as Bettina Kugel Hirsch, Bettina Hirsch and Bettina Kugel is an American film editor and an adjunct professor of editing at the University of Southern California (USC).
Tina Hirsch began to edit films in the late 1960s, including Death Race 2000 (1975) and the sequels More American Graffiti (1979) and Airplane II: The Sequel (1982). In the 1980s she edited the It's a Good Life sequence in the Twilight Zone: The Movie (1983) and also edited director Joe Dante's Gremlins (1984). Hirsch directed Munchies (1987), one of the many low budget movies that were imitative of Gremlins.
Hirsch edited episodes of the television series The West Wing (A Proportional Response, 1999, and What Kind of Day Has It Been, 2000), for which she was nominated for an Emmy award for "Outstanding Single Camera Picture Editing for a Series" and for which she also won an Eddie award from the American Cinema Editors. In 2005, she was nominated for a second Emmy for editing the television miniseries Back When We Were Grownups (2004).
She has been elected to membership in the American Cinema Editors (ACE), and she was the first female President of the honorary society. Hirsch currently serves on the board of ACE, and has done so for more than two decades.
Since 2003, Hirsch spends her time working as Adjunct Professor of editing at USC film school.

The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Tina Hirsch?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-downpandoragplaydeezerihearttuneinpandoragplaydeezerihearttuneinitunes