Quantcast
SG
comment(s)
191 views this wk.
Seth Grahame-Smith

Seth Grahame-Smith

US fiction author
The basics
About
Occupation Film producer Novelist Screenwriter
Country United States of America
AKA Seth Jared Greenberg
Date of birth Rockville Centre
Education Emerson College
Notable works Pride and Prejudice and Zombies, Abraham Lincoln, Vampire Hunter
Authority VIAF id IMDB id Library of congress id Openlibrary id ISNI id
The details
Biography

Seth Grahame-Smith (born Seth Jared Greenberg; January 4, 1976) is an American novelist, film director, film producer, and screenwriter. He is best known as the author of The New York Times best-selling novels Pride and Prejudice and Zombies and Abraham Lincoln, Vampire Hunter, both of which have been adapted as feature films. Grahame-Smith is also the co-creator, head writer and executive producer of The Hard Times of RJ Berger, a scripted television comedy appearing on MTV. In collaboration with David Katzenberg, his partner in Katzsmith Productions, Grahame-Smith is currently developing a number of projects for television and film.

Personal life

Grahame-Smith was born in Rockville Centre, New York, the son of Deborah Ann (née Williams) and Barry Michael Greenberg. He eventually grew up in Weston and Bethel, Connecticut, where he attended Bethel High School. His parents divorced when he was a child. Subsequently, his mother changed his surname to "Grahame", after author Kenneth Grahame, and later added the surname "Smith", from her remarriage. Grahame-Smith attended an Episcopal church after his mother's remarriage (his father was Jewish). His mother was a literary editor and his stepfather was a rare books dealer.

Grahame-Smith received a degree in film from Emerson College. He currently lives in Los Angeles with his wife, Erin, and sons, Joshua and Jacob.

Career

Literature

Grahame-Smith's first widely published book was The Big Book of Porn: A Penetrating Look at the World of Dirty Movies, a non-fiction history of the erotic art form published in 2005. The next year, Grahame-Smith published The Spider-Man Handbook: The Ultimate Training Manual, an examination of Marvel Comics' Spider-Man, with an introduction by Stan Lee. In 2007, Grahame-Smith wrote How to Survive a Horror Movie: All the Skills to Dodge the Kills, a tongue-in-cheek guide to help readers escape situations most often shown in horror films. The book's introduction was written by horror film director Wes Craven. Grahame-Smith's next book was the satirical Pardon My President: Fold-and-Mail Apologies for 8 Years, a collection of letters addressed to various parties intended to apologize for the wrongs they had suffered under the administration of George W. Bush.

The idea for Grahame-Smith's next novel, Pride and Prejudice and Zombies, came from his editor at Quirk Books, Jason Rekulak. Using Jane Austen's classic novel Pride and Prejudice as a platform, Rekulak suggested that Grahame-Smith mix a zombie plot into the public domain novel. Enamored of the idea, Grahame-Smith immediately began working on the novel, first by reading Pride and Prejudice and then by inserting the gruesome zombie elements, a process he has described as similar to microsurgery. Though Quirk Books was initially reluctant to publish the book in fear of alienating Austen's fans, the novel went to press in 2009, with modest sales expectations. In the weeks prior to the release, however, the book's popularity swelled dramatically as the cover and title of the novel circulated the internet. Anticipation for the book grew so rapidly that in its first week of release, Pride and Prejudice and Zombies surged to No. 3 on the New York Times Best Seller list. Since that time, the novel has sold over a million copies and been translated into over 20 languages.

Building on the success of Pride and Prejudice and Zombies, Grahame-Smith wrote another mash-up, Abraham Lincoln, Vampire Hunter. As the title suggests, this book traces Abraham Lincoln's life from childhood through assassination, relying upon his "secret diaries" to reveal his central role in a world-wide struggle against vampirism. Released on March 2, 2010, this novel debuted at No. 4 on The New York Times best seller list under the category "Hardcover Fiction."

In addition to writing novels, Grahame-Smith made his debut as a comic book writer on Marvel Zombies Return: Hulk with artist Richard Elson.

Unholy Night, Grahame-Smith's most recent novel, was released on April 10, 2012. It depicts Balthazar, Gaspar, and Melchyor, the Magi of popular tradition, as criminals who ultimately visit the infant Jesus. Herod the Great, Augustus Caesar, Pontius Pilate, and the Virgin Mary appear as supporting characters.

Film

Two of Grahame-Smith's best-selling books were made into feature films. Grahame-Smith adapted his book, Abraham Lincoln: Vampire Hunter, for the screen, for producers Tim Burton and Timur Bekmambetov. In 2011, Pride and Prejudice and Zombies was optioned by Lionsgate Entertainment, with Natalie Portman producing, and David O. Russell initially set to adapt and direct. Russell later left the project. In 2013, a new group of producers, including Portman, hired Burr Steers to direct. Lily James and Ellie Bamber were chosen to star as the oldest Bennett sisters. Pride and Prejudice and Zombies was released on February 5, 2016.

Grahame-Smith wrote the script for Tim Burton's Dark Shadows, the film adaptation of the 1960s soap opera, replacing longtime Burton scribe John August. Grahame-Smith produced the film adaptation of the Mark Bianculli and Jeff Richard spec script The Waiting. Smith polished the script for Fantastic Four. Smith will be producing the rebooted Gremlins film. He is also currently writing a script for the sequel to the 1988 supernatural comedy film Beetlejuice. The remake Something Wicked This Way Comes is set for his directorial debut. Smith is set to produce the remake of It, which will begin filming in June 2016 in Toronto.

Television

After receiving a degree in film from Emerson College, Grahame-Smith moved to Los Angeles, where he wrote and produced for several television series, including Vendettas and the History Channel's History's Mysteries. Building on these experiences, Grahame-Smith was hired to produce an innovative CBS online series, Clark and Michael, starring Clark Duke, Michael Cera, David Cross, Patton Oswalt, and Andy Richter.

While working on Clark and Michael, Grahame-Smith met another producer on the series, David Katzenberg (son of Jeffrey), who would become his partner in Katzsmith Productions. Under the Katzsmith banner, Grahame-Smith and Katzenberg created, wrote, and produced a scripted comedy for MTV called The Hard Times of RJ Berger, which follows an awkward high-school loser who gains notoriety for his extraordinary endowment. In January 2015, it was announced that he will write the screenplays for the sequels to Beetlejuice and Gremlins.

Through Katzsmith Productions, Grahame-Smith and Katzenberg are currently developing a number of projects for television and film.

Filmography

Films
Year Film Writer Producer Based on his novel Notes
2012 Dark Shadows Yes No No
Abraham Lincoln: Vampire Hunter Yes executive Yes
2016 Pride and Prejudice and Zombies No No Yes
2017 The Lego Batman Movie Yes No No
It No Yes No
The Lego Ninjago Movie No executive No
TBA Beetlejuice 2 Yes Yes No
Untitled Gremlins sequel No Yes No
The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Seth Grahame-Smith?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-downpandoragplaydeezerihearttuneinpandoragplaydeezerihearttuneinitunes