Suggest a change
72 views this week
Radi Abdullah

Radi Abdullah

Ismaili Imam
The basics
Date of birth
Date of death 881
Father: Muhammad at-Taqi (Ahmed ibn Abadullah)
Children: Abdullah al-Mahdi Billah
The details

ʿAbdullāh ar-Raḍī, (actual name Abu ʿAlī al-Ḥusayn ibn Aḥmad ibn ʿAbd Allāh ibn Muḥammad ibn Ismāʿīl (Arabic: ﺍلحسين بن أحمد بن عبد اللّه بن محمد بن إسماعيل‎; born 219 AH, died 268AH or 881 AD in Askar, Syria; Imamate: 225-268AH) surnamed al-Raḍī/al-Zakī) is the tenth Isma'ili Imam. He is successor to the ninth Imam, Muhammad at-Taqi (Ahmed ibn Abadullah), and the father of Abdullah al-Mahdi Billah, the Imam who founded the Fatimid Caliphate.

The eighth to tenth Isma'ili Imams were hidden from the public because of threats from the Abbasid Caliphate and were known by nicknames. However, the Dawoodi Bohra in their religious text, Taqqarub, claim to have the true names of all 21 imams in sequence, including those of the hidden Imams: the eighth Imam Ahmad al-Wafi (Abadullah), the ninth Imam Muhammad at-Taqi, and the tenth Imam, Raḍī Abdullah.

The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Radi Abdullah?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-down pandoragplay