996 views this week
Paul von Hindenburg

Paul von Hindenburg

Prussian-German field marshal, statesman, and president of Germany
The basics
Occupation Politician Officer
Country Germany Germany Germany
AKA Paul Ludwig Hans Anton von Beneckendorff und von Hindenburg
Date of birth Poznań, Greater Poland Voivodeship, Poland
Date of death Aug 02, 1934 Ogrodzieniec, Warmian-Masurian Voivodeship, Gmina Kisielice, Iława County, Warmian-Masurian Voivodeship
Children: Oskar von Hindenburg
Brother(s): Bernhard von Hindenburg
Spouse: Gertrud von Hindenburg
Awards Pour le Mérite, Knight of the Order of the Golden Fleece, Knight Grand Cross of the Military Order of Maria Theresa, Military Merit Cross, Order of the Black Eagle, Star of the Grand Cross of the Iron Cross, Large Military Merit Medal, Military Order of Max Joseph, Honorary doctor of the Dresden University of Technology
Authority VIAF id IMDB id Library of congress id Openlibrary id ISNI id NNDB id
The details

Paul Ludwig Hans Anton von Beneckendorff und von Hindenburg ( listen ), known generally as Paul von Hindenburg (German: [ˈpaʊl fɔn ˈhɪndn̩bʊʁk] ( listen); 2 October 1847 – 2 August 1934), was a Generalfeldmarschall (Field Marshal) and statesman who commanded the German military during the second half of World War I before later being elected President of the Weimar Republic in 1925. He played a key role in the Nazi "Seizure of Power" in January 1933 when, under pressure, he appointed Adolf Hitler chancellor of a "Government of National Concentration", even though the Nazis were a minority in cabinet and the Reichstag.

Hindenburg retired from the army for the first time in 1911, but was recalled shortly after the outbreak of World War I in 1914. He first came to national attention at the age of 66 as the victor of the decisive Battle of Tannenberg in August 1914. Upon being named Germany's Chief of the General Staff in August 1916, his popularity among the German public increased exponentially to the point of giving rise to an enormous personality cult. As Kaiser Wilhelm II increasingly delegated his power as Supreme Warlord to the German high command, Hindenburg and his deputy Erich Ludendorff ultimately formed a de facto military dictatorship that dominated German policymaking for the rest of the war.

Hindenburg retired again in 1919, but returned to public life in 1925 to be elected the second President of Germany. In 1932, Hindenburg was persuaded to run for re-election as German President, even though he was 84 years old and in poor health, because he was considered the only candidate who could defeat Hitler. Hindenburg was re-elected in a runoff. He was opposed to Hitler and was a major player in the increasing political instability in the Weimar Republic that ended with Hitler's rise to power. He dissolved the Reichstag twice in 1932 and finally, under pressure, agreed to appoint Hitler Chancellor of Germany in January 1933. Hindenburg did this to satisfy Hitler's demands that he should play a part in the Weimar Government, since Hitler was the leader of the Nazi party which had won the largest plurality in the November 1932 elections (no party achieved a majority). In February, he signed off on the Reichstag Fire Decree, which suspended various civil liberties, and in March he signed the Enabling Act of 1933, which gave Hitler's regime arbitrary powers. Hindenburg died the following year, after which Hitler declared himself Führer und Reichskanzler, or Supreme Leader and Chancellor, which superseded both the President and Chancellor.

Early life

Beneckendorff und von Hindenburg family arms
Paul von Hindenburg as a cadet in Wahlstatt (1860)

Paul Ludwig Hans Anton von Beneckendorff und von Hindenburg was born in Posen, Prussia (Polish: Poznań; until 1793 and since 1919 part of Poland), the son of Prussian aristocrat Hans Robert Ludwig von Beneckendorff und von Hindenburg (1816–1902) and his wife Luise Schwickart (1825–1893), the daughter of medical doctor Karl Ludwig Schwickart and wife Julie Moennich. His paternal grandparents were Otto Ludwig Fady von Beneckendorff und von Hindenburg (1778–18 July 1855), through whom he was remotely descended from the illegitimate daughter of Count Heinrich VI of Waldeck, and his wife Eleonore von Brederfady (died 1863). Hindenburg was also a direct descendant of Martin Luther and his wife Katharina von Bora, through their daughter Margareta Luther. Hindenburg's younger brothers and sister were Otto, born 24 August 1849, Ida, born 19 December 1851 and Bernhard, born 17 January 1859. One of his first-cousins was the great-grandmother of IKEA founder Ingvar Kamprad. His family were all Lutheran Protestants in the Evangelical Church of Prussia, which since 1817 included both Calvinist and Lutheran parishioners.

Paul was proud of his family and could trace ancestors back to 1289. The dual surname was adopted in 1789 to secure an inheritance and appeared in formal documents, but in everyday life they were von Beneckendorffs. True to family tradition his father supported his family as an infantry officer, he retired as a major. In the summer they visited his grandfather at the Hindenburg estate of Neudeck in East Prussia. At age 11 Paul entered the Cadet Corps School at Wahlstatt (now Legnickie Pole, Poland). At 16 he was transferred to the School in Berlin, and at 18 he served as a page to the widow of King Frederick William IV of Prussia. Graduates entering the army were presented to King William I, who asked for their father's name and rank. He became a second lieutenant in the Third Regiment of Foot Guards.

In the German Army

Hindenburg as a lieutenant in the 3rd Garderegiment in 1870

Action in two wars

When the Austro-Prussian War of 1866 broke out Hindenburg wrote his parents: "I rejoice in this bright-coloured future. For the soldier war is the normal state of things…If I fall, it is the most honorable and beautiful death". During the decisive battle at Königgrätz he was briefly knocked unconscious by a bullet that pierced his helmet and creased the top of his skull. Quickly regaining his senses, he wrapped his head in a towel and resumed leading his detachment, winning a decoration. He was battalion adjutant when the Franco-Prussian War (1870–1871) broke out. After weeks of marching, the Guards attacked the village of Saint Privat (near Metz). Climbing a gentle slope, they came under heavy fire from the superior French rifles. After four hours the Prussian artillery came up to blast the French lines while the infantry, filled with the "holy lust of battle, " swept through the French lines. His regiment suffered 1096 casualties, and he became regimental adjutant. The Guards were spectators at the Battle of Sedan and for the following months sat in the siege lines surrounding Paris. He was his regiment's elected representative at the Palace of Versailles when the German Empire was proclaimed on 18 January 1871; he was an impressive figure: 195 cm (6 feet 5 inches) tall with a muscular frame and striking blue eyes. After the French surrender he watched from afar the suppression of the Paris Commune.

General Staff

In 1873 he passed in the highly competitive entrance examination for admission to the Kriegsakademie in Berlin After three years study his grades were high enough for appointment to the General Staff. He was promoted to captain in 1878 and assigned to the staff of the Second Army Corps. He married the intelligent and accomplished Gertrud von Sperling (1860–1921) by whom he had two daughters, Irmengard Pauline (1880) and Annemaria (1891) and one son, Oskar (1883). Next he commanded an infantry company, in which his men were ethnic Poles.

Hindenburg as a Major General of the General Staff in 1897

He was transferred in 1885 to the General Staff and was promoted to major. His section was led by Count Alfred von Schlieffen, a noted student of encirclement battles like Cannae, whose famous Schlieffen Plan proposed to pocket the French Army. For five years Hindenburg also taught tactics at the Krieg-akademie. At the maneuvers of 1885 he met the future kaiser; they met again at the next year's war game in which Hindenburg commanded the “Russian army”. He learned the topography of the lakes and sand barrens of East Prussia during the annual Great General Staff's ride in 1888. The following year he moved to the War Ministry, to write the field service regulations on field-engineering and on the use of heavy artillery in field engagements — both were used during the First World War. He became a lieutenant-colonel in 1891 and two year later was promoted to colonel commanding an infantry regiment. He became chief of staff of the Eight Army Corps in 1896.

Field commands and retirement

He was given command of a division in 1897 as a major-general (equivalent to a British and US brigadier general) in 1897; in 1900 he was promoted to lieutenant general (major-general). Five years later he was made commander of the Fourth Army Corps based in Magdeburg as a General of the Infantry (lieutenant-general). (The German equivalent to four-star rank was Colonel-General). The annual maneuvers taught him how to maneuver a large force; in 1908 he defeated a corps commanded by the kaiser. In 1909 Schlieffen recommended him as Chief of the General Staff, but he lost out to Helmuth von Moltke.

He retired in 1911 “to make way for younger men.” He had been in the army for 46 years, including 14 years in General Staff positions.

World War I

Recalled to the army

Field Marshal Hindenburg in 1914

When the war broke out, Hindenburg was retired in Hanover. On 22 August, out of the blue, he was selected by the War Cabinet and the German high command (Oberste Heeresleitung, OHL) to assume command of the German Eighth Army in East Prussia, with General Erich Ludendorff as his chief of staff. After the Eighth Army had been defeated by the Russian 1st Army at Gumbinnen, it had found itself in danger of encirclement as the Russian 2nd Army under General Alexander Samsonov advanced from the south towards the Vistula River. Momentarily panicked, Eighth Army commander Maximilian von Prittwitz notified OHL of his intent to withdraw his forces into Western Prussia. The Chief of the German General Staff, Generaloberst Helmuth von Moltke, responded by relieving Prittwitz and replacing him with Hindenburg.


Upon arriving at Marienberg in 23 August, Hindenburg and Ludendorff were met by members of Eighth Army staff led by Lieutenant Colonel Max Hoffmann, an expert on the Russian army. Hoffman informed them of his plans to shift part of the 8th Army south to attack the exposed left flank of the advancing Russian Second Army. Agreeing with Hoffman's strategy, Hindenburg authorized Ludendorff to transfer most of the 8th Army south while leaving behind only two cavalry brigades to face the Russian First Army in the north. In Hindenburg's words, the line of soldiers that was defending Germany's border against the advancing Second Army were "thin, but not weak", because the men were defending their homes. If pushed too hard, he believed they would cede ground only gradually as German reinforcements continued to mass on the advancing Russians' flanks before ultimately encircling and annihilating them. On the eve of the ensuing battle, Hindenburg reportedly strolled close to the decaying walls of the fortress of the Knights of Prussia, recalling how the Knights of Prussia were defeated by the Slavs in 1410 at nearby Tannenberg.

Hindenburg and Ludendorff at Tannenberg (painting by Hugo Vogel)

On the night of 25 August Hindenburg told his anxious staff, "Gentlemen, our preparations are so well in hand that we can sleep soundly tonight”. On the day of the battle, Hindenburg reportedly watched from a hilltop as his forces' weak center gradually gave ground until the sudden roar of German guns to his right heralded the surprise attack on the Russians' flanks. Ultimately, Russian losses amounted to the capture of 92,000 Russians and another 78,000 killed or wounded while German casualties numbered only 14,000. According to British Field Marshal Edmund Ironside it was the "greatest defeat suffered by any of the combatants during the war". Hindenburg realized that he would become a national hero and acted swiftly to fit that part, asking the Kaiser to name the victory the Battle of Tannenberg.

After this decisive victory Hindenburg repositioned the Eighth Army to face the Russian First Army. Hindenburg's tactics spurned head-on attacks all along the front in favor of schwerpunkts, sharp, localized hammer blows. Two schwerpunkts struck in the First Battle of the Masurian Lakes, from these breakthrough points two columns drove east to pocket the Russians led by General Paul von Rennenkampf, who managed to retreat 100 km (62 mi) with heavy losses. In the first six weeks of the war the Russians had lost more than 310,000 men. Eight hundred thousand refugees were able to return to their East Prussian homes, thanks to victories that strikingly contrasted with the bloody deadlock that characterized the Western Front following the failure of the Schlieffen Plan.


Hindenburg saw his job clearly: "The commander in the field should only lay down the broad lines, leaving the details to his subordinates." He and Ludendorff would discuss what to do and then their staff would issue precise instructions. Despite their strikingly dissimilar temperaments, Ludendorff was a perfect fit; as Hindenburg wrote to the Kaiser a few months later: "He has become my faithful adviser and a friend who has my complete confidence and cannot be replaced by anyone." Ludendorff's weakness was nerves; twice during Tannenberg, fearful that they were about to be attacked in their rear, he proposed to shift troops from the left pincer to face the Vilnius Army; both times Hindenburg talked to him privately and they did not waver.

Defending Silesia

On the east bank of the Vistula in Poland the Russians were mobilizing new armies which were shielded from attack by the river; once assembled they would cross the river to march west into German Silesia. To counter this threat, the supreme commander and Prussian War Minister Erich von Falkenhayn, who had superseded Moltke, formed a new Ninth Army, which joined Hindenburg's command. He set up headquarters at Posen in West Prussia, accompanied by Ludendorff and Hoffmann. Although his 16 divisions faced 60 Russian, he advanced into Poland to occupy the west bank of the Vistula. The Austro-Hungarians guarded the river shore on the German right flank. When the Russians attempted to cross the Vistula, the Germans held firm, but the Russians were able to cross in the Austro-Hungarian sector. Hindenburg retreated, destroying all railways and bridges, sure that the pursuing Russians must stop when they were 120 km (75 mi) west of their railheads — well short of the German frontier. The Russians celebrated a victory, but the retreat gained the Germans vital weeks. Hindenburg faced adversity with "God be with us, I can do no more!". On 1 November 1914 he was appointed Ober Ost (commander in the east) and was promoted to field marshal. Once the Russians repaired the railways they would be in position to push into Silesia, so Hindenburg re-positioned to strike their flank by moving Ninth Army by rail north to Thorn and reinforcing it with two corps from Eighth Army. On 11 November, in a raging snowstorm, they surprised the Russian flank in the fierce Battle of Łódź, which ended the immediate Russian threat to Silesia and also captured Poland's second largest city.

Postcard of the wooden statue of Hindenburg erected in Berlin for the first anniversary of Tannenberg

Public Image

The most celebrated tribute to Hindenburg during the war was a 12m tall wooden likeness erected in Berlin. What admirers paid to drive in nails — ultimately 30 tons of them —went to war widows. Smaller versions were erected throughout Germany. The wooden images and his photographs, which invariably show the resolute, indomitable warrior, give a deceptively stern likeness. He reportedly had a good sense of humor and often made jokes at his own expense.” Visitors found that his headquarters seemed like a family. He had a prodigious memory for names and faces, asking colleagues about their sons in the army, even recalling their ranks and units. Despite this bonhomie, he kept his own counsel. According to the Kaiser, "Hindenburg never said more than half of what he really thought". When Professor Hugo Vogel, commissioned to immortalize the victorious Tannenberg commanders in paint, arrived at headquarters most of his subjects begrudged posing, Hindenburg visited most days, often staying for hours, which his staff attributed to ego, having no inkling that he and his wife collected paintings of the Virgin nor that he was an amateur artist nor that he liked to discuss books — Schiller was his favorite author. After a painting was completed Hindenburg would periodically check on how many printed reproductions had been sold. Vogel was with him throughout the war and did his last portrait in 1934. Protecting his warrior image, Hindenburg wrote in his memoir that "the artists were a distraction [with which] we would have preferred to dispense".


East or West?

Hindenburg argued that the still miserably equipped Russians — some only carried spears — in the huge Polish salient were in a trap in which they could be snared in a cauldron by a southward pincer from East Prussia and a northward pincer from Galicia, using motor vehicles for speed, even though the Russians outnumbered the Germans by three to one. From Hindenburg's point of view, such an overwhelming triumph could end the war in the Eastern Front. Falkenhayn rejected his plan as a pipe dream. Nevertheless, urged on by Ludendorff and Hoffman, Hindenburg spent the winter fighting for his strategy by badgering the Kaiser while his press officer recruited notables like the Kaiserin and the Crown Prince to “stab the kaiser in the back”. The kaiser compromised by keeping Falkenhayn in supreme command, but replacing him as Prussian war minister. In retaliation, Falkenhayn reassigned some of Hindenburg's forces to a new army group under Prince Leopold of Bavaria and transferring Ludendorff to a new joint German and Austro-Hungarian Southern Army. Hindenburg and Ludendorff reacted by threatening to resign thereby resulting in Ludendorff's reinstatement under Hindenburg's command.

Counterattacks in East Prussia & Poland

Following his return, Ludendorff provided Hindenburg with a depressing evaluation of their allies’ army, which already had lost many of their professional officers and had been driven out of much of Galicia, their part of what once had been Poland. Meanwhile, the Russians were inexorably pushing from Galicia toward Hungary through the Carpathian passes. Under orders from Falkenhayn to contain the resurgent Russians, Hindenburg mounted an unsuccessful attack in Poland with his Ninth Army as well as an offensive by his newly formed Tenth Army which made only local gains. Following these setbacks, he set up temporary headquarters at Insterburg, and made plans to eliminate the Russians' remaining toehold in East Prussia. In the ensuing assault, the Germans would ensnare the Russians in a pincer movement between the Tenth Army in the north and Eighth Army in the south between his Tenth Army in the north and Eighth Army in the south. The attack was launched on 7 February, they encircled an entire corps and captured more than 100,000 men in the Second Battle of the Masurian Lakes, afterwards pulling back to strong defensible positions, against which still more Russians were sacrificed.

The Austro-Hungarian fortress city of Przemyśl in Galicia, which had been besieged for months, surrendered on 23 March with the loss of 117,000 men. To drive the Russians out of the Carpathian passes the Austro-Hungarians proposed a joint strike on the Russian right flank. Falkenhayn agreed, so he moved OHL east to the castle of Pless and formed Army Group von Mackensen from a new German Eleventh Army and the Austro-Hungarian Fourth Army. German heavy artillery was brought east: Mackensen had more than 200 heavy guns, while his foes had 4 —the Russian's heavy guns were immobilized in fortresses. In April Mackensen broke through the Russian front between Gorlice and Tarnów. For weeks he continued to steamroller forward, his entire front stepping forward shoulder to shoulder eastward across Galicia, his guns smashing through hastily constructed Russian lines. Hindenburg was to pressure the Russians in the north. He moved headquarters to Lötzen, near the eastern boundary of East Prussia. Three cavalry divisions swept east into Courland, the barren, sandy region near the Baltic coast, in one of the war's most successful cavalry actions. The cavalry's gains were held by Hindenburg's new Nieman army, named after the river.

In June OHL ordered Hindenburg to attack frontally in Poland north of Warsaw, steamrollering toward the Narew River. Ludendorff, furious with dictated tactics and because they were prohibited from pressing on in Courland, sat on his hands. Hindenburg created Army Group Gallwitz—named after its commander—which when Berlin approved became Twelfth Army (Von Gallwitz is one of many able commanders selected by Hindenburg), who stayed at the new army's headquarters to be available if needed. They broke through the Russian lines after a brief, but intense bombardment directed by Lieutenant Colonel Georg Bruchmüller, an artillery genius recalled from medical retirement. One-third of the opposing Russian First Army were casualties in the first five hours. From then on Hindenburg often called on Bruchmüller. The Russians withdrew until they sheltered behind the Narev River. However, steamroller frontal attacks cost dearly: by 20 August Gallwitz had lost 60,000 men.

Evacuation of Poland

After the Russians abandoned Warsaw, it was occupied on 5 August by a new OHL Army Group under Prince Leopold of Bavaria. Eighty thousand Russians remained in the great fortress that guarded the city, Novogeorgievsk, expecting to hold out for months, but Falkenhayn brought up heavy artillery and they capitulated in days, losing 700 guns. Step by step the Russians withdrew from the Polish salient: scorching the earth and herding out a million inhabitants — Jews were treated especially harshly. Falkenhayn insisted on a head-on pursuit of the retreating Russians into Lithuania, according to Hindenburg “a pursuit in which the pursuer gets more exhausted than the pursued”. He wanted to do more than push them back. On 1 July both the Nieman and Tenth Armies thrust spear heads into Courland, attempting to pocket the defenders, but they were foiled by the prudent commander of the Fifth Russian Army who defied orders by pulling back into defensible positions shielding Riga. The German Tenth Army besieged Kovno, a Lithuanian city on the Nieman River defended by a circle of forts. It fell on 17 August, along with 1,300 guns and almost 1 million shells. On 5 August his forces were consolidated into Army Group Hindenburg, which took the city of Grodno after bitter street fighting, but the retreating defenders could not be trapped because the wretched rail lines lacked the capacity to bring up the needed men. They occupied Vilnus on 18 September, then halted on ground favorable for a defensive line.

On 7 October Austro-Hungarian and German troops in Army Group Mackensen invaded Serbia, capturing Belgrade, and then eastern Serbia was invaded by the Bulgarians, who were promised substantial territorial gains; they had fine men but had lost many officers in the Balkan Wars. Falkenhayn had rejected advice that the Bulgarians should attack further south, to try to encircle the Serbs. By 4 December the remaining Serbian troops had escaped into Albania.

In October Hindenburg moved headquarters to Kovno. They were responsible for 108,800 km2 (42,000 mi2) of conquered Russian territory, which was home to three million people and became known as Ober Ost. The troops built fortifications on the eastern border while Ludendorff “with his ruthless energy” headed the civil government, using forced labor to repair the war damages and to dispatch useful products, like hogs, to Germany. A Hindenburg son-in-law, who was a reserve officer and a legal expert, joined the staff to write a new legal code. Baltic Germans who owned vast estates feted Hindenburg and he hunted their game preserves.

Hindenburg judged their operations in 1915 as “unsatisfactory”, “The Russian bear had escaped our clutches” and abandoning the Polish salient had shortened their lines substantially. Contrariwise victorious Falkenhayn believed that “The Russian Army has been so weakened by the blows it has suffered that Russia need not be seriously considered a danger in the foreseeable future”. The Russians replaced their experienced supreme commander, Grand Duke Nicholas Nikolaevich, who Hindenburg regarded as skillful, with the amateurish Tsar. During 1915, 264,000 Germans were killed in the east, 169,000 in the west.


Hindenburg in 1916

Russians resurgent

Russia rebounded by adding two million men to their army. They were equipped with three million rifles, 6,000 machine guns, and 6,356 pieces of field artillery. Now 66 German battalions faced 400 Russian, who attacked on 18 March near Lake Naroch, bombarding with 982 guns each stocked with 1,000 shells. Their infantry advanced despite heavy snow on the date promised to their allies, day after day failing to breach the defenses, while the battlefield thawed into a marsh in which they lost nearly 100,000 soldiers.

The next Russian onslaughts were along 480 km (300 mi) of the southwestern front in present-day western Ukraine. Four armies commanded by General Aleksei Brusilov on 4 June attacked entrenchments that the Austro-Hungarians regarded as impregnable. Probing assault troops located three weak spots which then were struck in force. In nine days they captured more than 200,000 men and 200 guns, and pushed into open country. Austro-Hungarian troops were rushed back from the Italian Front. Every man was needed in the west, so German troops on the Eastern Front had to be shifted south to plug the gap. Then on 19 June the Russians struck further north near Kovel on a front of 7 km (4.3 mi) defended by Austro-Hungarian and German troops, beginning with a bombardment from 1,000 guns. Ober Ost desperately shored up weak points with defenders stripped from less threatened positions. Ludendorff was so distraught on the phone to OHL that General Wilhelm Groener (who directed the army's railroads and had been a competitor with Ludendorff on the General Staff) was sent to evaluate his nerves, which were judged satisfactory. For a week the Russians kept attacking: they lost 80,000 men; the defenders 16,000. On 16 July the Russians attacked the German lines west of Riga, where again they were thwarted by a stout defense.

Commander of the Eastern Front

On 27 July the Austro-Hungarians accepted Hindenburg as the commander of the Eastern Front (except for the Archdukes Karl's Army Group in southeast Galicia, in which the German Hans von Seeckt was chief of staff). General von Eichhorn took over Army Group Hindenburg, while Hindenburg and Ludendorff, on a staff train equipped with the most advanced communication apparatus, visited their new forces. At threatened points they formed mixed German and Austro-Hungarian units and other Austro-Hungarian formations were bolstered by a sprinkling of German officers. The derelict citadel of the Brest Fortress was refurbished as their headquarters. Their front was almost 1,000 km (620 mi) and their only reserves were a cavalry brigade plus some artillery and machine gunners. The Ottomans sent a corps to reinforce the German Southern Army, which had to hold Galicia because it was a major source of petroleum. The Russians then struck on Brusilov's right with their best troops, the Guards Army, and the heaviest artillery concentration yet seen on the Eastern Front. Their military maps were sketchy, because they had never planned to fight so deep in their own territory, so the Guards were sent to advance through a swamp; in a week they lost 80 percent of their men. Further south Brusilov did better, penetrating a few kilometers into Hungary, but when the front stabilized the Russians faced new fortifications dug and wired on the German pattern. Officers were exchanged between the German and Austro-Hungarian armies for training.

Supreme commander

Hindenburg drawn by his friend Hugo Vogel

In the west, the Germans were hemorrhaging in the battles of Verdun and the Somme. Influential OHL officers, led by the artillery expert Lieutenant Colonel Max Bauer, a friend of Ludendorff's, lobbied against Falkenhayn, deploring his futile steamroller at Verdun and his inflexible defense along the Somme, where he packed troops into the front-line to be battered by the hail of shells and sacked commanders who lost their front-line trench. German leaders contrasted Falkenhayn's bludgeon with Hindenburg's deft parrying. The tipping point came after Falkenhayn ordered a Bulgarian spoiling attack on the Entente lines in Macedonia, which failed with heavy losses. Thus emboldened, Romania declared war against Austro-Hungary on 27 August, adding 650,000 trained enemies who invaded Hungarian Transylvania. Falkenhayn had been adamant that Romania would remain neutral. During the kaiser's deliberations about who should command Falkenhayn said “Well, if the Herr Field Marshall has the desire and the courage to take the post”. Hindenburg replied “The desire, no, but the courage—yes”. Chancellor Bethmann-Hollweg favored Hindenburg, supposing him amenable to moderate peace terms, mistaking his amiability as tractability and unaware that he was intent on enlarging Prussia.

Hindenburg was summoned to Pless on 29 August where he was named Chief of the General Staff. Ludendorff demanded joint responsibility for all decisions”; Hindenburg did not demur. Henceforth, Ludendorff became the public face of OHL: signing most orders, directives and the daily press reports. The eastern front was commanded by Leopold of Bavaria, with Hoffmann as his chief of staff. Hindenburg was also appointed as Supreme War Commander of the armies of the Central Powers, with nominal control of six million men. The British were unimpressed: General Charteris, Haig's intelligence chief, wrote to his wife “poor old Hindenburg is sixty-four years of age, and will not do very much.” Contrary-wise, the German War Cabinet was impressed by his swift decisions. "Old man Hindenburg” ended the “Verdun folly“ and set in motion the "brilliant campaign" in Romania.

Hindenburg and Ludendorff visited the Western Front in September, meeting the Army commanders and their staffs as well as their leaders: Crown Prince Rupprecht of Bavaria, Albrecht, Duke of Württemberg and Crown Prince Wilhelm of Prussia. Both crown princes, with Prussian chiefs of staff, commanded Army Groups. Rupprecht and Albrecht were presented with field marshal's batons. Hindenburg told them that they must stand on the defensive until Romania was dealt with, meanwhile defensive tactics must be improved — ideas were welcome. A backup defensive line, which the Entente called the Hindenburg Line, would be constructed immediately. Ludendorff promised more arms. Rupprecht was delighted that two such competent men had “replaced the dilettante ′Falkenhayn.” Bauer was impressed that Hindenburg “saw everything only with the eye of the soldier.”


Northern Bulgaria was defended by Germans, Austro-Hungarians, Bulgarians, and Ottomans formed as Army Group Mackensen, German heavy artillery from Verdun was sent east. The Entente supported Romania by attacking from Macedonia, but were repelled. Mackensen seized the Romanian forts on the right bank of the Danube, while infantry and cavalry from the Western Front reinforced the Ninth Army in Hungarian Transylvania, which now was commanded by Falkenhayn (another of Hindenburg's prudent selections). In a month, he defeated the Romanian invaders at Hermannstadt and then in November thrust into Romania through passes in the Carpathian Mountains, while Mackensen crossed the Danube to cut off their retreat, but the Romanians moved swiftly, they and their Russian reinforcements formed a defensive line in Moldova after Bucharest fell on 6 December 1916. British saboteurs had time enough to burn the oil stores and to plug most of the wells. During the last months of the year the Russians continued vain assaults in Ukraine. In 1916 there were three Russian casualties on the Eastern Front for every two from the Central Powers and Russian morale was crumbling: “More than a dozen Russian regiments mutinied in the last weeks of 1916.” About 12% of the German casualties that year were on the Eastern Front. In the autumn, the Entente began to push the Bulgarians back in Macedonia. On 11 October Army Group Otto von Below was formed there from the Bulgarians, twenty German battalions and an Ottoman corps; their new line held.

Bolstering defense

OHL issued a Textbook of Defensive Warfare that recommended fewer defenders in the front line relying on light machine guns, if pushed too hard they were permitted to pull back. Attackers who penetrated the front line entered a battle zone, in which they were machine gunned from scattered emplacements and shelled by the German artillery, who knew the ranges and location of their own strong points. Then infantry counterattacked, while the attacker's artillery was blind because they were unsure where their own men were. A reserve division was positioned immediately behind the line, if it entered the battle it was commanded by the division whose position had been penetrated. (Mobile defense was also used in World War II.) Responsibilities were reassigned to implement the new tactics: front-line commanders took over reserves ordered into the battle and for flexibility infantry platoons were subdivided into eight man units under a noncom.

Field officers who visited headquarters often were invited to speak with Hindenburg, who inquired about their problems and recommendations. At this time he was especially curious about the eight man units, which he regarded as " the greatest evidence of the confidence which we placed in the moral and mental powers of our army, down to its smallest unit." Revised Infantry Field Regulations were published and taught to all ranks, including at a school for division commanders, where they maneuvered a practice division. A monthly periodical informed artillery officers about new developments. In the last months of 1916 the British battering along the Somme produced fewer German casualties. Overall, “In a fierce and obstinate conflict on the Somme, which lasted five months, the enemy pressed us back to a depth of about six miles on a stretch of nearly twenty-five miles” Thirteen new divisions were created by reducing the number of men in infantry battalions, and divisions now had an artillery commander. Every regiment on the western front created an assault unit of storm troopers selected from their fittest and most aggressive men. An air arm under Lieutenant General Ernst von Höppner was responsible for both aerial and antiaircraft forces; the army's vulnerable zeppelins went to the navy. Most cavalry regiments were dismounted and the artillery received their badly needed horses.

In October General Philippe Pétain began a series of limited attacks at Verdun, each starting with an intense bombardment coordinated by his artillery commander General Robert Nivelle. Then a double creeping barrage led the infantry into the shattered first German lines, where the attackers stopped to repel counterattacks. With repeated nibbles by mid-December 1916 the French retook all the ground the Germans had paid for so dearly. Nivelle was given command of the French Army.

Headquarters routine

Hindenburg's day at OHL began at 09:00 when he and Ludendorff discussed the reports — usually quickly agreeing on what was to be done. Ludendorff would give their staff of about 40 officers their assignments, while Hindenburg walked for an hour or so, thinking or chatting with guests. After conferring again with Ludendorff, he heard reports from his departmental heads, met with visitors and worked on correspondence. At noon Ludendorff gave the situation report to the kaiser, unless an important decision was required when Hindenburg took over. He lunched with his personal staff, which included a son-in-law who was an Army officer. Dinner at 20:00 was with the general staff officers of all ranks and guests — crowned heads, allied leaders, politicians, industrialists and scientists. They left the table to subdivide into informal chatting groups. At 21:30 Ludendorff announced that time was up and they returned to work. After a junior officer summarized the daily reports, he might confer with Ludendorff again before retiring.

The Hindenburg program

Ludendorff and Bauer, who knew all the industrialists, set ambitious goals for arms production, in what was called the Hindenburg Programme, which was directed from the War Office by General Groener. Major goals included a new light machine gun, updated artillery, and motor transport, but no tanks because they considered them too vulnerable to artillery. To increase output they needed skilled workers. The army released a million men. For total war, OHL wanted all German men and women from 15 to 60 enrolled for national service. Hindenburg also wanted the universities closed, except for medical training, so that empty places would not be filled by women. To swell the next generation of soldiers he wanted contraceptives banned and bachelors taxed. When a Polish army was being formed he wanted Jews excluded. Few of these ideas were adopted, because their political maneuvering was vigorous but inept, as Admiral Müller of the Military Cabinet observed “Old Hindenburg, like Ludendorff, is no politician, and the latter is at the same time a hothead.” For example, women were not included in the service law that ultimately passed, because in fact more women were already seeking employment than there were openings.

The extent of his command

The Austro-Hungarian emperor Franz Joseph died on 21 November. At the funeral Hindenburg met his successor Charles, who was frank about hoping to stop fighting. Hindenburg's Eastern Front ran south from the Baltic to the Black Sea through what now are the Baltic States, Ukraine, and Romania. In Italy, the line ran from the Swiss border on the west to the Adriatic east of Venice. The Macedonian front extended along the Greek border from the Adriatic to the Aegean. The line contested by the Russians and Ottomans between the Black and Caspian Sea ran along the heights of the Caucasus mountains. He urged the Ottomans to pull their men off the heights before winter, but they did not, he believed this was because of their "policy of massacre of the Armenians" and many froze. The front in Palestine ran from the Mediterranean to the southern end of the Dead Sea, and the defenders of Bagdad had a flank on the Tigris River. The Western Front ran southward from Belgium until near Laon, where it turned east to pass Verdun before again turning south to end at the Swiss Border. The remaining German enclaves in Africa were beyond his reach; an attempt to resupply them by dirigible failed. The Central Powers were surrounded and outnumbered.


Hindenburg and Ludendorff

Submarine warfare

Strengthening their army would take time: by the second quarter of 1917 the field army would have 680,000 more men in 53 new divisions and the supply of the new light machine guns would be adequate. Field guns would have increased from 5,300 to 6,700 and heavies from 3,700 to 4,340. They tried to foster fighting spirit by 'patriotic instruction’ with lectures and films to “ensure that a fight is kept up against all agitators, croakers and weaklings”. Meanwhile, they were sure to be attacked before their buildup was complete. In the interim the pressure might be reduced if the Navy waged unrestricted submarine warfare, which they claimed would defeat the British in six months. The chancellor and his camp were opposed, not wanting to bring the United States and other neutrals into the war. After securing the Dutch and Danish borders, Hindenburg announced that unrestricted submarine warfare was imperative and Ludendorff added his shrill voice. On 9 January the chancellor bowed to their unsound military judgments: underrating the United States and overrating their own navy.

OHL moved west to the pleasant spa town of Bad Kreuznach in southwest Germany, which was on a main rail line. The Kaiser's quarters were in the spa building, staff offices were in the orange court, and the others lived in the hotel buildings. In February a third Army Group was formed on the Western Front to cover the front in Alsace-Lorraine, it was commanded by Archduke Albrecht of Württemberg. Some effective divisions from the east were exchanged for less competent divisions from the west. Since their disasters of the previous year the Russian infantry had shown no fight and in March the revolution erupted in Russia. Shunning opportunity, the Central Powers stayed put — Hindenburg feared that invaders would resurrect the heroic resistance of 1812.

The great withdrawal and defending the Western Front

On the Western Front their huge salient between the valley of the Somme and Laon obviously was vulnerable to a pincer attack, which indeed the French were planning. The new Hindenburg line ran across its base. On 16 March they began Operation Alberich: moving out able-bodied inhabitants and portable possessions, destroying every building, all roads and bridges, cutting down every tree, fouling every well, and burning every combustible. In 39 days the Germans withdrew from a 1000 mi² (2,590 km²) area, more ground than they had lost to all Allied offensives since 1914. The cautiously following Allies also had to cope with booby traps, some exploding a month later. The new front was 42 km (26 mi) shorter freeing-up 14 German divisions.

On 9 April the British attacked. At Arras led by tanks and a creeping barrage, they took the German first and second lines and occupied part of their third while the Canadians swept the Germans completely off the Vimy Ridge.. There was consternation at OHL, their new defense had failed. It was Ludendorff's birthday but he refused to come to the celebratory dinner. Hindenburg “pressed the hand of my First Quartermaster-General with the words, ‘We have lived through more critical times than to-day together’” The British tried to exploit their opening with a futile cavalry charge but did not press further, because their attack was a diversion for coming French operations. In fact, their new defensive tactics had not been tested, because Sixth Army commander Ludwig von Falkenhausen had packed men in the front line and kept counterattack divisions too far back. He was replaced.

A week later the anticipated French offensive began, driving northward from the Aisne River, after six days of intensive shelling their infantry was led forward by 128 tanks, the first attack by massed tanks. Nivelle knew that the Germans had captured his detailed plans several weeks before, but followed them nonetheless. The first two German lines were taken at heavy cost and the French slowly advanced 4 km (2.5 mi) as the defense fell back to their main line of resistance — it was far from Nivelle's promise of a first day's advance of 10 km (6.2 mi). The attacks ended in early May when many French regiments refused to attack. The Germans never learned the extent of their enemy's demoralization. Nivelle was replaced by Pétain.

The Ottoman and Eastern Fronts

The British captured Baghdad on 11 March. The Ottomans had been promised that their empire would be defended, so all their troops in Europe returned home and in May Falkenhayn was appointed to command Army group F comprising two Ottoman armies along with three German infantry battalions with some artillery; to impress the enemy it was called The Asiatic Corps. Falkenhayn realized it would be difficult to retake Baghdad, so he took over the defense of the Gaza line in Palestine, which the British broke through in November. To spare the city OHL ordered him not to defend Jerusalem, which was occupied in December.

The revolutionary Russian government led by Alexander Kerensky remained at war, attacking and pushing back the Austro-Hungarians in Galicia on 1 July. To counter this success, on 18 July after a hurricane bombardment by 136 batteries directed by Bruchmüller a Schwerpunkt of six German divisions from the west broke a gap in the Russian front, through which they sliced southward toward Tarnopol, thereby threatening to pocket the Russian attackers, who fled to save themselves; many of the demoralized Russian units elected committees to replaced their officers. At the end of August the advancing Central Powers stopped at the frontier of Moldavia. To keep up the pressure and to seize ground he intended to keep, Hindenburg shifted north to the heavily fortified city of Riga (today in Latvia) which has the broad Dvina River as a moat. On 1 September the Eighth Army, led by Oskar von Hutier, attacked; Bruchmüller's bombardment, which included gas and smoke shells, drove the defenders from the far bank east of the city, the Germans crossed in barges and then bridged the river, immediately pressing forward to the Baltic coast, pocketing the defenders of the Riga salient. Next a joint operation with the navy seized Oesel and two smaller islands in the Gulf of Riga. The Bolshevik revolution took Russia out of the war, an armistice was signed on 16 December.

The Reichstag peace resolution

Kaiser Wilhelm II and Hindenburg

Hindenburg detested Chancellor Bethmann-Hollweg for dragging his feet about total and submarine warfare. Then in July the chancellor permitted the Reichstag to debate a resolution for peace without “annexations or indemnities”. Colonel Bauer and the Crown Prince rushed to Berlin to block this peril. The minister of war urged Hindenburg and Ludendorff to join them, but when they arrived the kaiser told them that “there could be no justification for their presence in Berlin”. They should “return in haste to Headquarters where they certainly would be much better occupied.” They returned as ordered and then immediately telegraphed their resignations, which the kaiser declined. The crisis was resolved when the monarchist parties voted no confidence in Bethmann-Hollweg, who resigned. Ludendorff and Bauer wanted to replace both the kaiser and chancellor by a dictator, but Hindenburg would not agree. Many historians believe that in fact Ludendorff assumed that role. The Reichstag passed a modified resolution calling for “conciliation” on 19 July, which the new chancellor Georg Michaelis agreed to "interpret".

The resolution became advantageous in August when the Pope called for peace. The German response cited the resolution to finesse specific questions like those about the future of Belgium. The industrialists opposed Groener's advocacy of an excess profits tax and insistence that workers take a part in company management. Ludendorff relieved Groener by telegram and sent him off to command a division.

Hindenburg's 70th birthday was celebrated lavishly all over Germany, 2 October was a public holiday, an honor that until then had been reserved only for the Kaiser. Hindenburg published a birthday manifesto, which ended with the words:

With God's help our German strength has withstood the tremendous attack of our enemies, because we were one, because each gave his all gladly. So it must stay to the end. ‘Now thank we all our God’ on the bloody battlefield! Take no thought for what is to be after the war! This only brings despondency into our ranks and strengthens the hopes of the enemy. Trust that Germany will achieve what she needs to stand there safe for all time, trust that the German oak will be given air and light for its free growth. Muscles tensed, nerves steeled, eyes front! We see before us the aim: Germany honored, free and great! God will be with us to the end!"

Victory in Italy

Bavarian mountain warfare expert von Dellmensingen was sent to assess the Austro-Hungarian defenses in Italy, which he found poor. Then he scouted for a site from which an attack could be mounted against the Italians. Hindenburg created a new Fourteenth Army with ten Austro-Hungarian and seven German divisions and enough airplanes to control the air, commanded by Otto von Below. The attackers slipped undetected into the mountains opposite to the opening of the Soča valley. The attack began during the night when the defender's trenches in the valley were abruptly shrouded in a dense cloud of poison gas released from 894 canisters fired simultaneously from simple mortars. The defenders fled before their masks would fail. The artillery opened fire several hours later, hitting the Italian reinforcements hastening up to fill the gap. The attackers swept over the almost empty defenses and marched through the pass, while mountain troops cleared the heights on either side. The Italians fled west, too fast to be cut off. Entente divisions were rushed to Italy to stem the retreat by holding a line on the Piave River. Below's Army was dissolved and the German divisions returned to the Western Front, where in October Pétain had directed a successful limited objective attack in which six days of carefully planned bombardment left crater-free pathways for 68 tanks to lead the infantry forward on the Lassaux plateau south of Laon, which forced the Germans off of the entire ridge — the French Army had recovered.

The treaty with Russia

In the negotiations with the Soviet Government, Hindenburg wanted to retain control of all Russian territory that the Central Powers occupied, with German grand dukes ruling Courland and Lithuania, as well as a large slice of Poland. Their Polish plan was opposed by Foreign Minister Richard von Kühlmann, who encouraged the kaiser to listen to the views of Max Hoffmann, chief of staff on the Eastern Front. Hoffmann demurred but when ordered argued that it would be a mistake bring so many Slavs into Germany, when only a small slice of Poland was needed to improve defenses. Ludendorff was outraged that the kaiser had consulted a subordinate, while Hindenburg complained that the kaiser “disregards our opinion in a matter of vital importance.” The kaiser backed off, but would not approve Ludendorff's order removing Hoffmann, who is not even mentioned in Hindenburg's memoir. When the Soviets refused the terms offered at Brest-Litovsk the Germans repudiated the armistice and in a week occupied the Baltic States, Belarus and Ukraine, which had signed the treaty as a separate entity. Now the Russians signed also. Hindenburg helped to force Kühlmann out in July 1918.


In January more than half a million workers went on strike, among their demands was a peace without annexations. The strike collapsed when its leaders were arrested, the labor press suppressed, strikers in the reserve called for active duty, and seven great industrial concerns were taken under military control, which put their workers under martial law. On 16 January Hindenburg demanded the replacement of Count von Valentini, the chief of the Civil Cabinet. The Kaiser bridled “I do not need your parental advice”, but nonetheless fired his old friend. The Germans were unable to tender a plausible peace offer because OHL insisted on controlling Belgium and retaining the French coalfields. All of the Central Power's cities were on the brink of starvation and their armies were on short rations, Hindenburg realized that "empty stomachs prejudiced all higher impulses and tended to make men indifferent.” He blamed his allies' hunger on poor organization and transportation, not realizing that the Germans would have enough to eat if they collected their harvest efficiently and rationed its distribution effectively.

Opting for a decision in the west

Map of the Michael offensive showing in red the section of the British front that was not assaulted frontally, its defenders were to be encircled by the attackers on their flanks.

German troops were in Finland, the Baltic States, Poland, Belarus, Ukraine, much of Romania, the Crimea, and in a salient east of Ukraine extending east almost to the Volga and south into Georgia and Armenia. Hundreds of thousands of men were needed to hold and police these conquests. More Germans were in Macedonia and in Palestine, where the British were driving north; Falkenhayn was replaced by Otto Liman von Sanders, who had led the defense of Gallipoli. All Hindenburg required was that these fronts stand firm while the Germans won in the west, where now they outnumbered their opponents. He firmly believed that his opponents could be crushed by battlefield defeats regardless of their far superior resources.

Offensive tactics were tailored to the defense. Their opponents were adopting defense in depth. He would attack the British because they were less skillful than the French. The crucial blow would be in Flanders, along the River Lys, where the line was held by the Portuguese Army. However, winter mud prevented action there until April. Consequently, their first attack, named Michael, was on the southern part of the British line, at a projecting British salient near Saint-Quentin. Schwerpunkts would hit on either side of the salient's apex to pocket its defenders, the V Corps, as an overwhelming display of German power.

Additional troops and skilled commanders, like von Hutier, were shifted from the east, Army Group von Gallwitz was formed in the west on 1 February. One quarter of the western divisions were designated for attack; to counter the elastic defense during the winter each of them attended a four-week course on infiltration tactics. Storm troops would slip through weak points in the front line and slice through the battle zone, bypassing strong points that would be mopped up by the mortars, flamethrowers and manhandled field guns of the next wave. As always surprise was essential, so the artillery was slipped into attack positions at night, relying on camouflage for concealment; the British aerial photographers were allowed free rein before D-day. There would be no preliminary registration fire, the gunners were trained for map firing in schools established by Bruchmüller. In the short, intense bombardment each gun fired in a precise sequence, shifting back and forth between different targets, using many gas shells to keep defenders immersed in a toxic cloud. On D-day, the air force would establish air supremacy and machine gun enemy strong points, also updating commanders on how far the attackers had penetrated. Signal lamps were used for messaging on the ground. Headquarters moved close to the front and as soon as possible would advance to pre-selected positions in newly occupied ground. OHL moved to Spa, Belgium while Hindenburg and Ludendorff were closer to the attack at Avesnes, France, which re-awoke his memories of occupied France 41 years before.

Breaking the trench stalemate

Operation Michael struck on 21 March. The first day's reports were inconclusive, but by day two they knew they had broken through some of the enemy artillery lines. But the encirclement failed because British stoutness gave V Corps time to slip out of the targeted salient. On day four they were moving on into open country when the kaiser prematurely celebrated by pinning the iron cross with sun's rays on Hindenburg's tunic, the first recipient since the medal was created for von Blücher. As usual Hindenburg set objectives as the situation evolved. South of the salient they had almost destroyed the British Fifth Army, so they pushed west to cut between the French and British Armies, but did not succeed because they advanced too slowly through the thrashed terrain of the former Somme battlefields and the ground devastated when withdrawing the year before and because troops stopped to loot food and clothing — hence they never broke through the Entente's fluid defensive line, manned by troops brought up and supplied by rail and motor transport. Then he hoped to get close enough to Amiens to bombard the railways with heavy artillery — they were stopped just short, after having advanced a maximum of 65 km (40 mi). Hindenburg also hoped that civilian morale would crumble because Paris was being shelled from by naval guns mounted on rail carriages 120 km (75 mi) away, but he underestimated French resiliency.

The Allied command was dismayed. French headquarters realized: "This much became clear from the terrible adventure, that our enemies were masters of a new method of warfare. ... What was even more serious was that it was perceived that the enemy's power was due to a thing that cannot be improvised, the training of officers and men."

Prolonging Michael with the drive west delayed and weakened the attack in Flanders. Again they broke through, smashing the Portuguese defenders and forcing the British from all of the ground they had paid so dearly for in 1917. However French support enabled the British to save Hazebrouck, the rail junction that was the German goal. To draw the French reserves away from Flanders, the next attack was along the Aisne River where Nivelle had attacked the year before. Their success was dazzling. The defender's front was immersed in a gas cloud fired from simple mortars, within hours they had reoccupied all the ground the French had taken by weeks of grinding, and they continued to sweep south through Champagne until they halted for resupply at the Marne River.

Hindenburg had lost 977,555 of his best men between March and the end of July, while their foe's ranks were swelling with Americans. His dwindling stock of horses were on the verge of starvation and his ragged men thought continually of food. One of the most effective propaganda handbills the British showered on the German lines listed the rations received by prisoners of war. His troops bridled at their officer's rations and reports of the ample meals at headquarters, in his memoirs Ludendorff devotes six pages to defending officer's rations and perks. After an attack the survivors needed at least six weeks to recuperate, but now crack divisions were recommitted much sooner. Tens of thousands of men were skulking behind the lines. Determined to win, he decided to expand the salient pointing toward Paris to strip more defenders from Flanders. The attack on General Henri Gouraud's French Fourth Army followed the now familiar scenario but was met by a deceptive elastic defense and was decisively repelled at the French main line of resistance. Hindenburg still intended to try the conclusive strike in Flanders, but before he could strike French and Americans led by light tanks smashed through the right flank of the German salient on the Marne. The German defense was halfhearted.They had lost. Hindenburg went on the defensive, withdrawing one by one from the salients created by their victories, evacuating their wounded and supplies and retiring to shortened lines. He hoped to hold a line until their enemies were ready to bargain.

Ludendorff's breakdown

Since their retreat from the Marne, Ludendorff had been distraught, shrieking orders and often in tears. At dinner on 19 July he responded to a suggestion of Hindenburg's by shouting "I have already told you that is impossible” — Hindenburg led him from the room. On 8 August the British completely surprised them with a well-coordinated attack at Amiens, breaking well into the German lines. Most disquieting was that some German commanders surrendered their units and that reserves arriving at the front were taunted for prolonging the war. For Ludendorff Amiens was the "black day in the history of the German Army". Bauer and others wanted Ludendorff replaced, but Hindenburg stuck by his friend, he knew that “Many a time has the soldier's calling exhausted strong characters". A sympathetic physician who was a friend of Ludendorff's persuaded him to leave headquarters temporarily to recuperate. (His breakdown is not mentioned in Hindenburg's or Ludendorff's memoirs.) On 12 August Army Group von Boehn was created to firm up the defenses in the Somme sector. On 29 September Hindenburg and Ludendorff told the incredulous kaiser that the war was lost and that they must have an immediate armistice.

Defeat and revolution

A new chancellor, Prince Maximilian of Baden, opened negotiations with President Woodrow Wilson, who would deal only with a democratic Germany. Prince Max told the kaiser that he would resign unless Ludendorff was dismissed, but that Hindenburg was indispensable to hold the army together. On 26 October the Kaiser slated Ludendorff before curtly accepting his resignation — then rejecting Hindenburg's. Afterwards, Ludendorff refused to share Hindenburg's limousine. Colonel Bauer was retired. Hindenburg promptly replaced Ludendorff with Groener, now chief of staff of Army Group Kiev, which was assisting a breakaway Ukrainian government to fend off the Bolsheviks while expropriating food and oil. Another brilliant appointment — a topnotch soldier who had worked with the social democratic politicians who were coming to the fore.

They were losing their allies. In June the Austro-Hungarians in Italy attacked the Entente lines along the Piave River but were repelled decisively. On 24 October the Italians crossed the river in the Battle of Vittorio Veneto, after a few days of resolute resistance the defense collapsed, weakened by the defection of men from the empire's subject nations and starvation: the men in their Sixth Army had an average weight of 120 lb (54 kg). On 14 October The Austro-Hungarians asked for an armistice in Italy, but the fighting went on. In September the Entente and their Greek allies attacked in Macedonia. The Bulgarians begged for more Germans to stiffen their troops, but Hindenburg had none to spare. Many Bulgarian soldiers deserted as they retreated toward home, opening the road to Constantinople. The Austro-Hungarians were pushed back in Serbia, Albania and Montenegro, signing an armistice on 3 November. The Ottomans were overextended, trying to defend Syria while exploiting the Russian collapse to move into the Caucasus, advancing through Armenia and Georgia intending to take over Muslim lands, despite Hindenburg's urging them to defend what they had. The British and Arabs broke through in September, capturing Damascus. The Armistice of Mudros was signed on 30 October.

Wilson insisted that the kaiser must go, but he refused to abdicate, he was determined to lead the Prussian Army home to suppress the growing rebellion, which had started with large demonstrations in major cities and then, when the navy ordered a sortie to battle the British, mutineers led by workers' and soldiers' councils took control of the navy, these councils spread rapidly throughout Germany. They stripped officers of their badges of rank and decorations, if necessary forcibly. On 8 November Hindenburg told the kaiser that 39 regimental officers had been brought to Spa; where he delivered a situation report and answered questions. Then Hindenburg left and Goerner asked them to confidentially answer two questions about whether their troops would follow the kaiser. The answers were decisive: the army would not. The kaiser gave in, superfluously because in Berlin Prince Max had already publicly announced his abdication, his own resignation, and that the Social Democrat leader Friedrich Ebert was now chancellor. Democracy came abruptly and almost bloodlessly. That evening Groener telephoned Ebert, who he knew and trusted, to tell him that if the new government would fight Bolshevism and support the Army then the field marshal would lead a disciplined army home. Hindenburg's remaining in command bolstered the new government's position.

The Hindenburg villa in Hanover

The withdrawal became more fraught when the armistice obliged all German troops to leave Belgium, France and Alsace Lorraine in 14 days and to be behind the Rhine in 30 days. Stragglers would become prisoners. When the seven men from the executive committee of the soldiers' council formed at Spa arrived at OHL they were greeted politely by a lieutenant colonel, who acknowledged their leadership. When they broached the march home he took them to the map room, explaining allocation of roads, scheduling unit departures, billeting and feeding. They agreed that the existing staffs should make these arrangements. To oversee the withdrawals OHL transferred headquarters from Belgium to Kassel in Germany, unsure how their officers would be received by the revolutionaries. They were greeted by the chairman of the workers' and soldiers' council's who proclaimed that: "Hindenburg belongs to the German nation." His staff intended to billet him in the kaiser's palace there, Wilhelmshöhe. Hindenburg refused because they did not have the kaiser's permission, instead settling into a humble inn, thereby pleasing both his monarchist staff and the revolutionary masses. In the west 1.25 million men and 0.5 million horses were brought home in the time allotted. A brilliant display of the army's competence.

Hindenburg did not want to involve the army in the defense of the new government against their civil enemies. Instead they manned independent Freikorps (modeled on formations used in the Napoleonic wars), supplying them with weapons and equipment. In February 1919 OHL moved east to Kolberg to mount an offensive against impinging Soviet troops, but they were restrained by the Allied occupation administration, which in May 1919 ordered all German troops in the east home. Hindenburg retired to Hanover once again on 25 June 1919 to a splendid new villa, which was a gift of the city, despite admittedly having "lost the greatest war in history".

His military reputation

“Victory comes from movement” was Schlieffen's principle for war. His disciple Hindenburg expounded his ideas as an instructor of tactics and then applied them on World War I battlefields: his retreats and mobile defenses were as skillful and daring as his slashing Schwerpunkt attacks, which even broke through the trench barrier on the Western Front. He failed to win because once through they were too slow—legs could not move quite fast enough. (With engines, German movement overwhelmed western Europe in World War II.)

Surprisingly, Hindenburg has undergone a historical metamorphosis: his teaching of tactics and years on the General Staff forgotten while he is remembered as a commander as an appendage to Ludendorff's genius. Winston Churchill in his influential history of the war, published in 1923, depicts Hindenburg as a figurehead awed by the mystique of the General Staff, concluding that “Ludendorff throughout appears as the uncontested master.” Churchill led the way: later he is Parkinson's “beloved figurehead”, while to Stallings he is "an old military booby.” These distortions stemmed from Ludendorff, who strutted in the limelight during the war and immediately thereafter wrote his comprehensive memoir with himself center stage. Hindenburg's far less detailed memoir never disputed his valued colleague's claims, military decisions were made by “we” not “I”, and it is less useful to historians because it was written for general readers. Ludendorff continued touting his preeminence in print, which, typically, Hindenburg never disputed publicly.

Others did. The OHL officers who testified before the Reichstag committee investigating the collapse of 1918 agreed that Hindenburg was always in command. He managed by setting objectives and appointing talented men to do their jobs, for instance "giving full scope to the intellectual powers" of Ludendorff. Naturally these subordinates often felt that he did little, even though he was setting the course. In addition Ludendorff overrated himself, repressing repeated demonstrations that he lacked the backbone essential to command. Postwar he displayed extraordinarily poor judgment and a penchant for bizarre ideas, contrasting sharply with his former commander's surefooted adaptations to changing times.

Most of their conferences were in private, but on 26 July 1918 the chief of staff of the Seventh Army, Fritz von Lossberg traveled to OHL to request permission to withdraw to a better position

Without knocking I entered Ludendorff's office and found him loudly arguing with the field marshal. I assumed it was over the situation at the Seventh Army. In any case as soon as I entered the field marshall asked me to give my assessment of the situation at the Seventh Army. I described it in short terms and emphasized especially that based on my own observations I thought the condition of the troops was cause for serious concern. For the past few days the Seventh Army commanding general, the staff, and I had all been recommending a withdrawal from the increasingly untenable front lines. I told Hindenburg that I had come to Avesenes with the concurrence of the Seventh Army commanding general to secure such an order. The field marshall turned to Ludendorff, saying something to the effect of 'Now Ludendorff, make sure that the order goes out immediately. ' He then left Ludendorff's office rather upset.


Hindenburg's record as a commander starting in the field at Tannenberg, then leading four national armies, culminating with breaking the trench deadlock in the west, and then holding his defeated army together, is unmatched by any other soldier in World War I.

However, military skill should not mask the other component of their record: "... in general, the maladroit politics of Hindenburg and Ludendorff led directly to the collapse of 1918...."

In the Republic

The new republic held its first election on 19 January 1919. Parties representing a broad range of different constituencies ran candidates and voting was with proportional representation, so inevitably governments were formed by coalitions of parties: this time Social Democrats, Democrats, and Centrists. Ebert was elected as provisional chancellor; then the elected representatives assembled in Weimar to write a constitution. It was based on the Constitution of the German Empire written in 1871, with many of the kaiser's powers now given to a president elected for a term of seven years. The president selected the chancellor and the members of the cabinet, but with the crucial stipulation that his nominees had to be ratified by the Reichstag, which because of proportional representation required support from several parties. The constitution was adopted on 11 August 1919. Ebert was elected as provisional president.

Early in 1919 the Allies ordered the German Army to keep troops in Latvia and Lithuania to assist in repelling the Bolsheviks.

The terms of the Treaty of Versailles were written in secret. It was unveiled on 7 May 1919, on the fourth anniversary of the sinking of the Lusitania. It was followed by an ultimatum: either ratify the treaty, or the Allies would take whatever measures they deemed necessary to enforce its terms. While Germans of all political shades cursed the treaty as an insult to the nation's honor, President Ebert was sober enough to consider the possibility that Germany would not be in a position to turn it down. To save face, he asked Hindenburg whether the army was prepared to defend against an Allied invasion from the west, which Ebert believed would be all but certain if the treaty were voted down. If there was even the slightest chance that the army could hold out, he promised to urge rejection of the treaty. Under some prodding from his chief of staff, Groener, Hindenburg concluded the army could not resume the war under any circumstances. Rather than tell Ebert himself, he directed Groener to deliver the army's recommendation to the president. With just 19 minutes to spare, Ebert informed French Premier Georges Clemenceau that Germany would ratify the Treaty, which was signed on 28 June 1919 (the fifth anniversary of the assassination of Archduke Franz Ferdinand).

Second retirement

Back in Hanover, as a field marshal he was provided with a staff who helped with his still extensive correspondence. He made few formal public appearances, but the streets around his house often were crowded with admirers when he took his afternoon walk. During the war he had left the newspaper reporters to Ludendorff, now he was available. He hunted locally and elsewhere, including an annual chamois hunt in Bavaria. The yearly Tannenberg memorial celebration kept him in the public eye.

A Berlin publisher urged him to produce his memoirs which could educate and inspire by emphasizing his ethical and spiritual values; his story and ideas could be put on paper by a team of anonymous collaborators and the book would be translated immediately for the worldwide market. Mein Leben (My Life) was a huge bestseller, presenting to the world his carefully crafted image as a staunch, steadfast, uncomplicated soldier. Major themes were the need for Germany to maintain a strong military as the school teaching young German men moral values and the need to restore the monarchy, because only under the leadership of the House of Hohenzollern could Germany become great again, with "The conviction that the subordination of the individual to the good of the community was not only a necessity, but a positive blessing ...". Throughout the kaiser is treated with great respect. He concealed his cultural interests and assured his readers: "It was against my inclination to take any interest in current politics." (Despite what his intimates knew of his "deep knowledge of Prussian political life".) Mein Leben was dismissed by many military historians and critics as a boring apologia that skipped over the controversial issues, but it painted for the German public precisely the image he sought.

Hindenburg's son and two son-in-laws came though the war unscathed — Ludendorff had lost two beloved stepsons and Ebert two sons. The Treaty required the German army to have no more than 100,000 men and abolished the General Staff. Therefore, in March 1919 The Reichswehr was organized. The 430,000 armed men in Germany competed for the limited places. Both Major Oskar Hindenburg and his army officer brother-in-law were selected. The chief of staff was Seeckt, camouflaged as Chief of the Troop Office. He favored staff officers above line officers and the proportion of nobles was the same as prewar.

In 1919, Hindenburg was subpoenaed to appear before the parliamentary commission investigating the responsibility for the outbreak of war in 1914 and for the defeat in 1918. He was wary, as he had written: "The only existing idol of the nation, undeservedly my humble self, runs the risk of being torn from its pedestal once it becomes the target of criticism.". Ludendorff was summoned also. They had been strangers since Ludendorff's dismissal, but they prepared and arrived together on 18 November 1919. Hindenburg refused to take the oath until Ludendorff was permitted to read a statement that they were under no obligation to testify since their answers might expose them to criminal prosecution, but they were waving their right of refusal. On the stand Hindenburg read through a prepared statement, ignoring the chairman's repeated demands that he answer questions. He testified that the German Army had been on the verge of winning the war in the autumn of 1918 and that the defeat had been precipitated by a Dolchstoß ("stab in the back") by disloyal elements on the home front and unpatriotic politicians, quoting an unnamed British general: "The German Army was stabbed in the back." When his reading was finished Hindenburg walked out of the hearings, despite being threatened with contempt, sure that they would not dare charge a war hero. His testimony introduced the Dolchstoßlegende, which was adopted by nationalist and conservative politicians who sought to blame the socialist founders of the Weimar Republic for losing the war. Reviews in the German press that grossly misrepresented General Frederick Barton Maurice's book about the last months of the war firmed-up this myth. Ludendorff had used these reviews to convince Hindenburg.

Paul and Gertrud von Hindenburg

The first presidential election was scheduled for 6 June 1920. Hindenburg wrote to Wilhelm II, in exile in the Netherlands, for permission to run. Wilhelm approved, so on 8 March Hindenburg announced his intention to seek the presidency. Five days later Berlin was seized by regular and Freicorp troops led by General Lüttwitz, the commander of the Berlin garrison, who proclaimed a prominent civil servant, Wolfgang Kapp, president in a new government. Ludendorff and Max Bauer stood by Kapp's side. The legal government fled without attempting any forceful response; a general strike paralyzed the nation so after six days the putsch collapsed. It was followed by a Bolshevik uprising that was put down forcefully. Kapp died in prison while awaiting trial, Ludendorff fled to Bavaria where he was shielded by his fame, Bauer went into exile. The Reichstag canceled the election and extended Ebert's term of office until 25 June 1925. Hindenburg cut back on public appearances.

His serenity was shattered by the illness of his wife Gertrud, who died of cancer on 14 May 1921. He kept close to his three children, their spouses and his nine grandchildren. His son Oskar was at his side as the field marshal's liaison officer.

Germany's travails seemed unending. The national resources were drained by reparations payments, while tax income did not match expenditures. The gap was met by printing money without backing. In 1923 inflation began to accelerate, the fall in value became exponential. Savings were wiped away, wage earners survived with daily payments of more and more marks, which they rushed to spend before prices shot up further. Landowners paid off mortgages for a song and clever entrepreneurs with assets borrowed money to buy property from those who had to sell to survive. Hindenburg was sustained by a fund set up by a group of admiring industrialists.

On 8 November 1923 Hitler, with Ludendorff at his side, launched the Beer Hall Putsch in Munich, which was bloodily suppressed by the police. Hindenburg was not involved but inevitably was prominent in newspaper reports. He issued a statement urging national unity. On 16 November the Reichsbank introduced the Rentenmark, which was indexed to gold bonds. Twelve zeros were cut from prices, which stabilized. The political divisions in the nation began to ease. The foreign minister was Gustav Stresemann, the leader of the German People's Party. His goal was to restore Germany to its prewar status, but as a master of diplomacy he worked quietly a step at a time, first gaining Allied trust by ending the passive resistance to their occupation of the Ruhr. In 1924 the economy was shored up by the reduction in reparation payments in the Dawes Plan with loans from American banks. At Tannenberg in August before a crowd of 50,000 Hindenburg laid the headstone for an imposing memorial for the crucial German victory.

1925 election

Reichpräsident Ebert died on 28 February 1925 following an appendectomy. A new election had to be held within a month. None of the candidates attained the required majority, Ludendorff was last with a paltry 280,000 votes. By law there had to be another election. The Social Democrats, the Catholic Centre and other democratic parties united to support the Centre's Wilhelm Marx, who had twice served as chancellor and was now Minister President of Prussia. The Communists insisted on running their own candidate. The parties on the right established a committee to select their strongest candidate. After a week's indecision they decided on Hindenburg, despite his advanced age and fear, notably by Foreign Minister Stresemann, of unfavorable reactions by their former enemies. A delegation came to his home on 1 April. He stated his reservations but concluded "If you feel that my election is necessary for the sake of the Fatherland, I'll run in God's name." However some parties on the right still opposed him. Not willing to be humiliated like Ludendorff he drafted a telegram declining the nomination, but before it was sent Admiral Alfred von Tirpitz and a young leader of the East German agrarian nobility arrived in Hanover to persuade him to wait until the strength of his support was clearer. His conservative opponents gave way so he consented on 9 April. Again he obtained Wilhelm II's approval. His campaign stressed his devotion to "social justice, religious equality, genuine peace at home and abroad." "No war, no internal uprising, can emancipate our chained nation, which is, unfortunately, split by dissension." He addressed only one public meeting, held in Hanover, and gave one radio address on 11 April calling for a Volksgemeinschaft (national community) under his leadership. The second election, held on 26 April 1925, required only a plurality, which he obtained thanks to the support of the Bavarian People's Party (BVP), which had switched from Marx, and by the refusal of the Communists to withdraw their candidate Ernst Thälmann. In Britain and France the victory of the aged field marshal was accepted with equanimity.

Parliamentary governments

The presidential palace

He took office on 12 May 1925, "... offering my hand in this hour to every German". He moved into the elegant Presidential Palace on the Wilhelmstrasse, accompanied by Oskar — his military liaison officer— and Oskar's wife and three children. Always a stickler about uniforms, soon the servants had new regalia with the shoe buckles appropriate for a court. Nearby was the chancellery, which during Hindenburg's tenure would have seven residents. The president also enjoyed a shooting preserve. He notified Chancellor Hans Luther that he would replace the head of Ebert's Presidential staff, Dr Otto Meissner, with his own man, because the cabinet would have to consent. Meissner was kept on temporarily. He proved invaluable and was Hindenburg's right hand throughout his presidency.

Foreign Minister Stresemann had vacationed during the campaign so as not to tarnish his reputation with the victors by supporting the field marshal. The far right detested Stresemann for promoting friendly relations with the victors. At their first meeting Hindenburg listened attentively and was persuaded that Stresemann's strategy was correct. He was cooler at their next, reacting to rightist backlash. Nonetheless he supported the government's policy, so on 1 December 1925 the Locarno Treaties were signed, a significant step in restoring Germany's position in Europe. The right was infuriated because the Treaty accepted the loss of Alsace and Lorraine, though it mandated the withdrawal of the Allied troops occupying the Rhineland. The president always was lobbied intensely by visitors and letter writers. Hindenburg countered demands to restore the monarchy by arguing that restoring a Hohenzollern would block progress in revising Versailles. He accepted the republic as the mechanism for restoring Germany's position in Europe, though Hindenburg was no Vernunftrepublikaner (republican by reason) because democracy was incompatible with the militaristic volksgemeinschaft (national community) that would unite the people into one for future conflicts.

The Treaty ended Luther's government, so Hindenburg had to assemble its replacement. The president could not command, but had to practice politics in the raw: painstakingly listening to and negotiating with party leaders to put together a bloc with a majority. Occasionally he was able to seal a deal as the revered, old field marshal by appealing to patriotism. After weeks of negotiations, Luther formed a new government with a cabinet drawn from the middle-of-the road parties, retaining Stresemann, which the Reichstag approved when threatened that otherwise the president would call new elections. That government was toppled by dispute over flying the old imperial flag alongside of the Weimar colors, which symbolically downgraded the republic. Marx was recalled as chancellor in a government that continued the dual flag policy. The next major issue was the properties of the former kings now held by the states: the question was whether former rulers should receive some compensation or none. More than 12 million voters petitioned for a referendum on this issue, meanwhile the Reichstag was debating an expropriation bill. Hindenburg's impulse was to resign so that he might express his opposition, but instead Meissner persuaded him to write a personal letter, which appeared in the newspapers, opposing expropriation. The referendum on 20 June 1926 rejected expropriation. Hindenburg urged the states to reach fair settlements promptly, otherwise he would resign. Stresemann's position in successive governments was solidified when he shared the Nobel Peace Prize for 1926.

The next crisis came in the autumn of 1926 when Reichswehr commander Seeckt, without consulting the Reichswehr minister, invited the eldest son of the ex-crown prince to attend maneuvers. To keep the government in office, Hindenburg pressured Seeckt to resign. His successor was Wilhelm Heye. The Social Democrats shifted their stance and were willing to join a centrist government, which would strengthen it. Hindenburg was agreeable. But then the socialists demanded a completely new cabinet, which the government rejected, consequently the Reichstag voted no confidence after oratory that made much of the secret collaboration between the Reichswehr and the Red Army, which had been revealed in British newspapers. To counter these attacks the Reichswehr relied on Colonel Kurt von Schleicher, who had served with Oskar in the Third Guards and was often a guest at the Palace. He assiduously strove to improve relations with the Republic. Again Hindenburg was saddled with finding a new government. He asked Marx to bring in more parties. The German Nationals agreed to join, and a new government was in place on 31 January 1927. It legislated the eight hour day and unemployment insurance.

On 18 September 1927 Hindenburg spoke at the dedication of the massive memorial at Tannenberg, outraging international opinion by denying Germany's responsibility for initiating World War I, thereby repudiating Article 231 of the Treaty of Versailles. He declared that Germany entered the war as "the means of self-assertion against a world full of enemies. Pure in heart we set off to the defence of the fatherland and with clean hands the German army carried the sword." His words were much stronger than in the draft approved by Stresemann. The Allied governments retaliated by not congratulating him on his eightieth birthday. (He was more upset by Ludendorff's refusal to have any contact at the ceremony.) Most Germans did celebrate his birthday, his present was Neudeck, the ancestral East Prussian estate of the Hindenburgs, purchased with funds from a public subscription. Later it became known that the title was in Oskar's name, to avoid potential inheritance tax.

A financial scandal in the navy led to the resignation of the defense minister. As his replacement, Schleicher wanted Groener, whose chief-of-staff he had been late in the war. The right strongly opposed him, but the Reichstag approved. Groener in turn enhanced Schleicher's role in the army. The Reichstag's four-year term was coming to an end, so Hindenburg pressed them to promptly pass needed legislation and then dissolved them on 31 March 1928. His leadership was widely applauded. The election on 20 May 1928 produced a shift to the left, although a handful of Nazis were elected. However it was difficult to assemble a new government because several parties were reluctant to participate. Finally there was sufficient support for the Social Democrat Hermann Müller who Hindenburg found clever and agreeable, later telling Groener that Müller was his best chancellor.

Presidential governments

The next crisis followed Stresemann's negotiation of the Young Plan, which rescheduled reparations payments and opened the way for needed American loans. In addition, the French promised to leave the Rhineland in 1930, five years before schedule. The right formed a committee to block adoption, they started by intensively lobbying Hindenburg, using such powerful voices as Tirpitz. Hindenburg did not budge. For the first time the committee brought conservatives, like the powerful newspaper owner Alfred Hugenberg, into alliance with the Nazis. They submitted the issues to a national plebiscite, in which they obtained only one-fifth of the vote. In his open letter when he promulgated the required legislation, Hindenburg pointed out that their major problem was the economic turmoil and growing unemployment stemming from the worldwide depression.

The per cent of German workers unemployed 1920-1935

His close advisers were Oskar, Groener, Meissner, and Schleicher, known as the Kamarilla. The younger Hindenburg, "the constitutionally unforeseen son of the President", controlled access to the President. Hindenburg tried to assemble the next government by obtaining enough support from political parties while retaining essential ministers such as Groener and Stresemann, but was unable to form a working combination, the parties were too diverse and divided. A new election would only reinforce these bitter divisions. Schleicher proposed a solution: a government in which the chancellor would be responsible to the president rather than the Reichstag, based on the so-called "25/48/53 formula"., named for the three articles of the Constitution that could make such a "Presidential government" possible:

  • Article 25 allowed the President to dissolve the Reichstag.
  • Article 48 allowed the president to sign emergency bills into law without the consent of the Reichstag. However, the Reichstag could cancel any law passed by Article 48 by a simple majority vote within sixty days of its passage.
  • Article 53 allowed the president to appoint the chancellor.

Schleicher suggested that in such a presidential government the trained economist and leader of the Catholic Center Party (Zentrum) Heinrich Brüning would make an excellent chancellor. Hindenburg first talked with Brüning in February 1930. He was impressed by his probity and by his outstanding combat record as a machine gun officer; and was reconciled to his being a catholic. In January 1930, Meissner told Kuno von Westarp that soon Muller's "Grand Coalition" would replaced by a "presidential government" that would exclude the Social Democrats, adding that the coming "Hindenburg government" would be "anti-Marxist" and "anti-parliamentarian", serving as a transition to a dictatorship. Schleicher maneuvered to exacerbate a bitter dispute within Müller's coalition which was divided over whether the unemployment insurance rate should be raised by a half percentage point or a full percentage point. With the Grand Coalition government lacking support in the Reichstag, Müller asked Hindenburg to have his budget approved under Article 48, but Schleicher persuaded Hindenburg to refuse. Müller's government fell on 27 March 1930 and Brüning became chancellor. Brüning had hesitated because he lacked parliamentary support, but Hindenburg appealed to his sense of duty and threatened to resign himself. Only the four Social Democrats in the previous cabinet were replaced, forming what the press labeled the "Hindenburg Cabinet", which Dorpalen argues "failed to produce the hoped for turn of events. The depression grew worse, unemployment was soaring, and now the constitutional system had been drastically shaken.

President Hindenburg as painted by Max Liebermann

Urged on by the president, the Reichstag passed a bill supporting agriculture by raising tariffs and providing subsidies. Faced with declining tax revenues and mounting costs for unemployment insurance, Brüning introduced an austerity budget with steep spending cuts and steep tax increases. The Young Plan required such a balanced budget. Nonetheless, his budget was defeated in the Reichstag in July 1930, so Hindenburg signed it into law by invoking Article 48. The Reichstag voted to repeal the budget, so Hindenburg dissolved it just two years into its mandate, and re-approved the budget with Article 48. Unemployment was still soaring. Hindenburg took no part in the campaign, in the September 1930 elections the Nazis achieved an electoral breakthrough, gaining 17 percent of the vote to become the second strongest party in the Reichstag. The Communists also made striking gains, albeit not so great.

After the elections, Brüning continued to govern largely through Article 48; his government was kept afloat by the Social Democrats who voted against canceling his Article 48 bills in order to avoid another election that could only benefit the Nazis and the Communists. The German historian Eberhard Jäckel concluded that presidential government was within the letter of the constitution, but violated its spirit as Article 54 stated the Chancellor and his cabinet were responsible to the Reichstag, and thus presidential government was an end-run around the constitution. Hindenburg for his part grew increasingly annoyed with Brüning, complaining that he was growing tired of using Article 48 all the time to pass bills. Hindenburg found the detailed notes that Brüning submitted explaining the economic necessity of each of his bills to be incomprehensible. Brüning continued with austerity, A decree in December 1930 once again cut the wages of public employees and the budget. Modest, withdrawn Brüning was completely unable to explain his measures to the voters, or even to the president, who relied on explanations from the Kamarilla. The Nazis and German Nationals marched out of the Reichstag in opposition to a procedural rule. Then the 1931 budget was passed easily and the Reichstag adjourned until October after only increasing the military budget and the subsidies for Junkers in the so-called Osthilfe (Eastern Aid) program. In June 1931 there was a banking crisis in which the funds on deposit plummeted. Complete disaster was averted by United States President Herbert Hoover obtaining a temporary moratorium on reparation payments.

In the summer of 1931, Hindenburg complained in a letter to his daughter: "What pains and angers me the most is being misunderstood by part of the political right". He met Adolf Hitler for the first time in October 1931, at a high-level conference in Berlin. Everyone present saw that they took an immediate dislike to each other. Afterwards Hindenburg in private often disparagingly referred to Hitler as "that Austrian corporal", "that Bohemian corporal" or sometimes simply as "the corporal" and also derided Hitler's Austrian dialect. For his part, Hitler often labeled Hindenburg as "that old fool" or "that old reactionary". On 26 January 1933, Hindenburg privately told a group of his friends: "Gentlemen, I hope you will not hold me capable of appointing this Austrian corporal to be Reich Chancellor". Hindenburg made it clear that he saw himself as the leader of the "national" forces and expected Hitler to follow his lead.

In foreign politicts he engaged in hostile policy towards Poland, often expressing hope that Polish state would disappear from map of Europe "at appropriate moment"

Second presidency

Election poster for Hindenburg in 1932 (translation: "With him")

By January 1932, at age 84, Hindenburg was vacillating about running for a second term. Some authors have pointed out that uncertainty is suggestive of early senile dementia, which includes: restricted memory, especially of recent events and people, decrease in willed actions which may become apathy, and reduced problem solving ability. Brüning recalled that once the president came to meet him at the railway station, but failed to recognize him. On the other hand, Franz von Papen, a later chancellor, found that despite minor lapses the president remained competent until his last days. Hindenburg was persuaded to run by the Kamarilla, and supported by the Centre Party, the DVP and the Social Democratic Party of Germany (SPD), which regarded him as the only hope of defeating Hitler. His fighting spirit was evoked by Nazi taunts when he appeared in public and in a few weeks three million Germans signed a petition urging him to carry on. His intentions were not to "abandon my efforts for a healthy move to the Right". Brüning proposed to the Reichstag that in light of the still escalating economic disaster — now some of the largest banks had failed — the election should be postponed for two years, which would have required a two-thirds assent, to which the Nazis would never agree. Hitler was to be one of his opponents in the election. Hindenburg left most campaigning to others, in his single radio address he stressed the need for unity, "I recall the spirit of 1914, and the mood at the front, which asked about the man, and not about his class or party". Hitler campaigned vigorously throughout Germany.

Hindenburg, aged 84, at a radio microphone in 1932 during the election campaign in which he defeated Hitler.

In the first round of voting in March 1932, Hindenburg was front-runner, but failed to gain the required majority. In the runoff the following month Hindenburg won with 53 percent of the vote. However he was disappointed because he lost voters from the right, only winning by the support of those who had strongly opposed him seven years before. He wrote "Despite all the blows in the neck I have taken, I will not abandon my efforts for a healthy move to the Right". He called in the party leaders for advice, during the meetings Meissner led the discussions while Hindenburg would only speak briefly on crucial points. Schleicher took the lead in choosing the cabinet, in which he was Reichswehr Minister. Groener was now even more unpopular to the right because he had banned wearing party uniforms in public. On 13 May 1932 Schleicher told Groener that he had "lost the confidence of the Army" and must resign at once. Once Groener was gone the ban was lifted and the Nazi brown shirts were back battling on the streets.

To cope with mounting unemployment, Brüning desperately wanted an emergency decree to launch a program in which bankrupt estates would be carved up into small farms and turned over to unemployed settlers. When they met, Hindenburg read a statement that there would be no further decrees and insisted that the cabinet resign, there must be a turn to the right. Brüning resigned on 1 June 1932. He was succeeded by Papen from the Centre Party, who was Schleicher's choice, Hindenburg did not even ask the party leaders for advice. He was delighted with Papen, a rich, smooth aristocrat who had been a famous equestrian and a general staff officer; he soon became a Hindenburg family friend (Schleicher was no longer welcomed because he had quarreled with Oscar). The president was delighted to find that eight members of the new cabinet had served as officers during the war.

Thanks to the previous government, reparations were phased out at the Lausanne Conference, but without progress on other issues, so it was attacked by the German right. The Social Democratic government of the State of Prussia was a care-taker, because they had lost their mandate in the preceding election. Papen accused them of failing to maintain public order and removed them on 20 July. The national elections came eleven days later. Eight parties received substantial numbers of votes, but those supporting the government lost strength, while opponents on the right and left gained. The Nazis polled almost the same 37 percent they had in the presidential election, making them the largest party in the Reichstag. Schleicher negotiated with them, proposing that Hitler become vice-chancellor. Hitler demanded the chancellorship along with five cabinet positions and important posts in the state governments. Additionally the Reichstag must pass an Enabling act giving a new government all needed powers, otherwise it would be dissolved. Around the country Nazi storm-troopers were running riot, attacking their political opponents. Hindenburg refused to make Hitler chancellor, so he met with Hitler to explain that he was unwilling to bring a single party to power, concluding with "I want to extend my hand to you as a fellow soldier." The following morning he left for Neudeck; most of the newspapers praised his defense of the constitution. The constitution mandated a new election within sixty days, but owing to the crisis Hindenburg postponed it. Papen published an economic recovery plan that almost all of the parties and the labor unions lambasted. His scant support crumbled further.

To add enough votes to gain a parliamentary mandate Schleicher tried to persuade some of the Nazi leaders, like the war hero Hermann Göring, to defect and to take a position in his government. None of them would, so he became another presidential chancellor, still courting prominent Nazis — otherwise his days as chancellor were numbered. Papen continued to negotiate with Hitler, who moderated his conditions: he would settle for the chancellorship, the Reich Commissioner of Prussia and two cabinet positions: interior and a new slot for aviation. He also promised that he would respect the rights of the president, the Reichstag and the press, and Papen would be vice-chancellor. On these terms, Hindenburg allowed Oskar and Meissner to meet secretly with Hitler, culminating in an hour's tête-á-těte between Hitler and Oskar. Schleicher learned of the secret meeting and the following morning met with the president to demand emergency powers and the dissolution of the Reichstag. Hindenburg refused the powers but agreed to the election. Before a new government could be formed Hindenburg called General Werner von Blomberg, an opponent of Schleicher, back from a disarmament conference and appointed him Reichswehr minister, perhaps unaware that he was a Nazi sympathizer.

Hitler becomes chancellor

To break the stalemate the president proposed Hitler as chancellor, Papen as vice-chancellor and Reich commissioner of Prussia, and Göring as Prussian interior minister (who controlled the police), two other cabinet ministers would be Nazis, the remaining eight would be from other parties. When the president met with Hitler, Papen would always be present. The new cabinet included only three Nazis–Hitler, Göring and Wilhelm Frick. Besides Hitler, Frick was the only Nazi with a portfolio; he held the nearly powerless Interior Ministry (unlike the rest of Europe, at the time the Interior Ministry had no power over the police, which was the responsibility of the Länder). Göring did not receive a portfolio, but critically was made Prussian interior minister, controlling the largest police force in which he promoted Nazis as commanders. Blomberg was Reichswehr minister, Hugenberg was both economics and agriculture minister, and Seldte (the leader of the right wing Stahlhelm party) was labor minister. The other ministers were holdovers from the Papen and Schleicher cabinets.

Hitler's first act as chancellor was to ask Hindenburg to dissolve the Reichstag, so that the Nazis and DNVP could win an outright majority to pass the Enabling Act that would give the new government power to rule by decree, supposedly for the next four years. Unlike laws passed by Article 48, which could be cancelled by a majority in the Reichstag, under the Enabling Act the Chancellor could pass laws by decree that could not be cancelled by a vote in the Reichstag. Hindenburg agreed to this request. In early February 1933, Papen asked for and received an Article 48 bill signed into law that sharply limited freedom of the press. After the Reichstag fire on 27 February, Hindenburg, at Hitler's urging, signed into law the Reichstag Fire Decree via Article 48, which effectively suspended all civil liberties in Germany. Göring as Prussian Interior Minister had enlisted thousands of Sturmabteilung (SA) men as auxiliary policemen, who attacked political opponents of the Nazis with Communists and Social Democrats being singled out for particular abuse. Fritz Schäffer, a conservative Catholic and a leading politician of the Bavarian People's Party met Hindenburg on 17 February 1933 to complain about the ongoing campaign of terror against the SPD. Schäffer told Hindenburg: "We reject the notion that millions of Germans are not to be designated as national. The socialists served in the trenches and will serve in the trenches again. They voted for the banner of Hindenburg...I know many socialists who have earned acclaim for their service to Germany; I need only mention the name of Ebert". Hindenburg, who had always hated the Social Democrats rejected Schäffer's appeal, saying that the SPD were "traitors" who had "stabbed the Fatherland in the back" in 1918 (Hindenburg seems to have convinced himself of the reality of the Dolchstoßlegende by this point) who could never belong to the volksgemeinschaft and the Nazis had his full support in their campaign against the Social Democrats.

Hindenburg disliked Hitler, but he approved of his efforts to create the volksgemeinschaft, writing to his daughter on 17 February 1933 that he could feel the "Spirit of 1914" returning as "Patriotic revival very gratifying; may God preserve our unity!". For Hindenburg, the "Government of National Concentration" headed by Hitler was the fulfillment of what he had been seeking since 1914, the creation of the volksgemeinschaft. Despite the ensuing anti-red hysteria, the Nazis received only 43.9% of the vote, though with the support of the DNVP they had a majority in the Reichstag.

Hitler and Hindenburg at the Garrison Church in Potsdam

Hitler soon obtained Hindenburg's confidence, promising that after Germany regained full sovereignty, the monarchy would be restored; after a few weeks Hindenburg no longer asked Papen to join their meetings. The opening of the new Reichstag was celebrated with a Nazi extravaganza: Hindenburg descended into the crypt of the old garrison church in Potsdam to commune with the spirit of Frederick the Great at his grave, attended by Hitler who saluted the president as "the custodian of the new rise of our people." An Enabling Act was prepared that transferred law-making from the Reichstag to the government, even if the new laws violated the constitution. With the Communist deputies and many Social Democrats kept out of the chamber (in violation of Articles 36 and 37 of the constitution), the Reichstag passed the Act with well more than the needed two-thirds majority, effectively ending the Republic. As it turned out, that meeting took place in such an intimidating atmosphere that the Enabling Act would have garnered the required supermajority even with all deputies present and voting.

During 1933 and 1934, Hitler was very aware of the fact that Hindenburg, as President and supreme commander of the armed forces, was now the only check on his power. With the passage of the Enabling Act and the banning of all parties other than the Nazis, Hindenburg's power to dismiss Hitler from office was effectively the only means by which he could be legally dismissed. Given that Hindenburg was still a popular war hero and a revered figure in the Reichswehr, there was little doubt that the Reichswehr would side with Hindenburg if he ever decided to sack Hitler. Thus, as long as Hindenburg was alive, Hitler was always very careful to avoid offending him or the Army. Although Hindenburg was in increasingly bad health, the Nazis made sure that whenever Hindenburg did appear in public it was in Hitler's company. During these appearances, Hitler always made a point of showing him the utmost respect and deference. However, in private, Hitler continued to detest Hindenburg, and expressed his hope that "the old reactionary" would hurry up and die as soon as possible.

The Tannenberg Memorial where Hindenburg and his wife were buried.

Economic austerity was abandoned as Hitler poured money into new programs hiring the unemployed, buying armaments, and building infrastructure—especially roads and autobahns. Within a year unemployment fell by almost 40%. Hitler gained the support of the armed forces by promising to rebuild their strength. The German states were taken over by the national government, the labor unions were suppressed, political opponents were imprisoned, and Jews were ejected from the civil service which included the universities. Hindenburg only objected about the Jews; he wanted war veterans retained, to which Hitler acceded. When Hitler moved to eject Hugenberg from the cabinet and to suppress the political parties, a trusted colleague of Hugenberg's was sent to Neudeck to appeal for assistance but only met with Oskar. The president did delay the appointment of one Nazi Gauleiter, but failed to obtain the installation of a Lutheran bishop he favored. The honor guard at Neudeck now were storm troopers. On 27 August at the stirring ceremonies at Tannenberg the president was presented with two large East Prussian properties near Neudeck. On the night before the plebiscite on Nazi rule scheduled for 11 November 1933, Hindenburg appealed to the voters to support their president and their chancellor, 95.1% of those voting did so. When a new commander of the army was to be appointed the president's choice won out over the chancellor's, but Hindenburg accepted a change in the military oath that eliminated obedience to the president and placed the swastika on military uniforms. By summer 1934, Hindenburg was dying of metastasized bladder cancer and his correspondence was dominated by complaints of Nazi storm troopers running amok, so Hindenburg asked Hitler to rein them in. Immediately after the storm troopers’ leaders were murdered during the Night of the Long Knives Hindenburg thanked Hitler for his firm measures. A day later he learned that Schleicher and his wife had been gunned down in their home; Hitler apologized, claiming that Schleicher had drawn a pistol.

In the fall of 1933, a group of Hindenburg's friends led by General August von Cramon asked Hindenburg to restore the monarchy. Hindenburg replied: "Of course, I recognize your fidelity to our Kaiser, King and Lord without reservation. But precisely because I share this sentiment, I must urgently warn against the step you plan to take. ... The domestic crisis is not yet completely over, and foreign powers will have a hard time imagining me on the sidelines if it comes to a restoration of the monarchy. ... To say this is unbelievably painful for me."

During the summer of 1934, Hindenburg grew increasingly alarmed at Nazi excesses. With his support, Papen gave a speech at the University of Marburg on 17 June calling for an end to state terror and the restoration of some freedoms. When Propaganda Minister Joseph Goebbels got wind of it, he not only canceled a scheduled tape-delayed broadcast of the speech, but ordered the seizure of newspapers in which part of the text was printed.

Papen was furious, telling Hitler that he was acting as a "trustee" of Hindenburg, and that a "junior minister" like Goebbels had no right to silence him. He resigned and immediately notified Hindenburg about what happened. Hindenburg told Blomberg to give Hitler an ultimatum—unless Hitler took steps to end the growing tension in Germany and rein in the SA, he would dismiss Hitler, declare martial law and turn the government over to the army. Not long afterward, Hitler carried out the Night of the Long Knives, for which he received the personal thanks of Hindenburg in a telegram. However, during the Nuremberg Trials Hermann Goring admitted the telegram was never seen by Hindenburg, and was actually written by the Nazis.


Hindenburg remained in office until his death at the age of 86 from lung cancer at his home in Neudeck, East Prussia, on 2 August 1934. On August 1, Hitler had got word that Hindenburg was on his deathbed. He then had the cabinet pass the "Law Concerning the Highest State Office of the Reich," which stipulated that upon Hindenburg's death, the offices of president and chancellor would be merged under the title of Leader and chancellor (Führer und Reichskanzler).

Two hours after Hindenburg's death, it was announced that as a result of this law, Hitler was now both Germany's head of state and head of government, thereby cementing his status as the absolute dictator of Germany. Publicly, Hitler announced that the presidency was "inseparably united" with Hindenburg, and it would not be appropriate for the title to ever be used again.

In truth, Hitler had known as early as April 1934 that Hindenburg would likely not survive the year. He worked feverishly to get the armed forces—the only group in Germany that would be nearly powerful enough to remove him with Hindenburg gone—to support his bid to become head of state after Hindenburg's death. In a meeting aboard the Deutschland on April 11 with Blomberg, army commander Werner von Fritsch and naval commander Erich Raeder, Hitler publicly proposed that he himself succeed Hindenburg. In return for the armed forces' support, he agreed to suppress the SA and promised that the armed forces would be the only bearers of arms in Germany under his watch. Raeder agreed right away, but Fritsch withheld his support until May 18, when the senior generals unanimously agreed to back Hitler as Hindenburg's successor.

Hitler had a plebiscite held on 19 August 1934, in which the German people were asked if they approved of Hitler merging the two offices. The Ja (Yes) vote amounted to 90% of the vote.

In taking over the president's powers for himself without calling for a new election, Hitler technically violated the Enabling Act. While the Enabling Act allowed Hitler to pass laws that contravened the Weimar Constitution, it specifically forbade him from interfering with the powers of the president. Moreover, the Weimar Constitution had been amended in 1932 to make the president of the High Court of Justice, not the chancellor, acting president pending a new election. However, Hitler had become law unto himself by this time, and no one dared object.

Contrary to Hindenburg's will, he was interred with his wife in a magnificent ceremony at the Tannenberg Memorial. In 1944 as the Russians approached Generalleutnant Oskar von Hindenburg moved his parents' remains to western Germany. After World War II the Poles razed the Tannenberg Memorial to the ground.

The remains of Hindenburg and his wife currently lie buried in St. Elizabeth's Church, Marburg.


Silver 5 mark commemorative coin of Paul von Hindenburg, struck 1936
Obverse: Paul von Hindenburg, 1847–1934 Reverse: (German) Deutsches Reich, 5 RM

The famed zeppelin Hindenburg that was destroyed by fire in 1937 was named in his honor, as was the Hindenburgdamm, a causeway joining the island of Sylt to mainland Schleswig-Holstein that was built during his time in office. The previously Upper Silesian town of Zabrze (German: Hindenburg O.S.) was also renamed after him in 1915, as well as the SMS Hindenburg, a battlecruiser commissioned in the Imperial German Navy in 1917 and the last capital ship to enter service in the Imperial Navy. The Hindenburg Range in New Guinea, which includes perhaps one of the world's largest cliffs, the Hindenburg Wall, also bears his name.

Historical assessment as president

Historian Christopher Clark has criticized Hindenburg in his role as head of state for:

″...withdrawing his solemn constitutional oaths of 1925 and 1932 to make common cause with the sworn enemies of the Republic. And then, having publicly declared that he would never consent to appoint Hitler to any post...levered the Nazi leader into the German Chancellery in January 1933. The Field Marshal had a high opinion of himself, and he doubtless sincerely believed that he personified a Prussian ‘tradition" of selfless service. But he was not, in truth, a man of tradition...As a military commander and later as Germany's head of state, Hindenburg broke virtually every bond he entered into. He was not the man of dogged, faithful service, but the man of image, manipulation and betrayal.″

Decorations and awards

  • Kingdom of Prussia:
    • Knight of the Order of the Black Eagle
    • Grand Commander of the Royal House Order of Hohenzollern with Swords
    • Pour le Mérite (2 September 1914); Oak Leaves added on 23 February 1915
    • Iron Cross, 1st and 2nd class
    • Grand Cross of the Iron Cross (9 December 1916); Golden Star added on 25 March 1918 (Star of the Grand Cross of the Iron Cross)
  • Kingdom of Bavaria: Knight Grand Cross of the Military Order of Max Joseph
  • Kingdom of Saxony: Knight Grand Cross of the Military Order of St. Henry
  • Kingdom of Württemberg: Knight of the Order of Military Merit
  • Oldenburg: Knight Grand Cross with Crown, Swords and Laurel of the House and Merit Order of Peter Frederick Louis
  • Mecklenburg-Schwerin: Military Merit Cross, 1st class
  • Anhalt: Friedrich Cross, 1st class
  • Honorary Commander of the Order of Saint John (Bailiwick of Brandenburg)
  • Austrian Empire:
    • Grand Cross of the Military Order of Maria Theresa
    • Cross of Military Merit, 1st class with war decoration
    • Gold Medal of Military Merit ("Signum Laudis")
  • Kingdom of Spain: Knight of the Order of the Golden Fleece (Spain)
The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Paul von Hindenburg?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-down pandoragplay