Quantcast
MM
comment(s)
373 views this wk.
Melissa McCarthy

Melissa McCarthy

American actress and comedian
The basics
About
Occupation Actor Comedian Film producer Screenwriter Television actor Television producer Writer
Country United States of America
AKA Melissa Ann McCarthy
Date of birth Plainfield, Will County, Illinois, U.S.A.
Family
Spouse: Ben Falcone
Stats
Height: 1.5748 m
Education Joliet Catholic Academy
Authority ISNI id Library of congress id All Movie id IMDB id NNDB id VIAF id
The details
Biography

Melissa Ann McCarthy (born August 26, 1970) is an American actress, writer, producer, and fashion designer. She is a two-time Primetime Emmy Award winner, from eight nominations. She also received nominations for a Golden Globe Award, two Screen Actors Guild Awards, a BAFTA Award, and the Academy Award for Best Supporting Actress, among other accolades.

She began appearing in television and films in the late 1990s, and first gained nationwide recognition for her role as Sookie St. James on the television series Gilmore Girls (2000–2007). She played Dena on the ABC sitcom Samantha Who? (2007–2009), before starring as Molly Flynn on the CBS sitcom Mike & Molly (2010–2016), the latter of which earned her a Primetime Emmy Award for Outstanding Lead Actress in a Comedy Series, as well as two other nominations during subsequent seasons. She has also been nominated five times for the Primetime Emmy Award for Outstanding Guest Actress in a Comedy Series for her five appearances as a host on Saturday Night Live, eventually winning in 2017.

McCarthy achieved widespread recognition and critical acclaim for her performance in the comedy film Bridesmaids (2011); for her work in the film, she received nominations for the BAFTA Award, Screen Actors Guild Award, and Academy Award for Best Supporting Actress. She also had supporting roles in The Nines (2007), The Back-up Plan (2010), Life as We Know It (2010), This Is 40 (2012), and The Hangover Part III (2013). McCarthy then starred in the comedy films Identity Thief and The Heat, both released in 2013. In 2014, McCarthy starred in the comedy film Tammy and the comedy-drama film St. Vincent. In 2015, she headlined the action comedy film Spy, for which she received a Golden Globe Award nomination. In 2016, she starred in the comedy films The Boss and Ghostbusters. In 2018, she stars in the comedy films Life of the Party, The Happytime Murders, and the critically acclaimed biographical comedy-drama Can You Ever Forgive Me?

McCarthy and her husband Ben Falcone founded On the Day, a production company. In 2015, she received a star on the Hollywood Walk of Fame, launched her clothing line, Melissa McCarthy Seven7, and was named the third highest-paid actress in the world by Forbes. In 2016, Forbes named her the world's second highest-paid actress in the world, with earnings of $33 million.

Early life

McCarthy was born in Plainfield, Illinois to Sandra and Michael McCarthy. She is a cousin of actress and model Jenny McCarthy and professional basketball player Joanne McCarthy. McCarthy was raised on a farm in a large Catholic family. Her father is of Irish descent, while her mother is of English, German, and Irish ancestry. Some of her ancestors were from County Cork. She graduated from St. Francis Academy (now Joliet Catholic Academy) in Joliet, Illinois. Her career started with stand-up comedy in Los Angeles, and later in New York City. McCarthy is an alumna of The Groundlings, an improvisational and sketch comedy troupe based in Los Angeles, California.

Career

1997–2010: Early work, Gilmore Girls and Samantha

McCarthy made her first television appearance in an episode of the NBC comedy series Jenny, opposite her cousin Jenny McCarthy. She made her feature film debut in a minor role in the 1999 comedy Go, and later had roles in the movies Drowning Mona, Disney's The Kid, Charlie's Angels, The Third Wheel and The Life of David Gale. She also worked in three episodes of Kim Possible, voicing DNAmy. In 2000, McCarthy was cast as Sookie St. James, the upbeat and klutzy best friend of Lorelai Gilmore, on The WB television series Gilmore Girls. Throughout the series, Sookie is Lorelai's business partner and cheerleader. On April 7, 2016, McCarthy announced on The Ellen DeGeneres Show that she would be returning for the show's revival, Gilmore Girls: A Year in the Life, on Netflix. The latter was released November 25, 2016 and McCarthy appears in one of its four episodes.

In 2007, she starred opposite Ryan Reynolds in the science fantasy psychological thriller The Nines, written and directed by John August. She later starred in the independent comedies The Captain, Just Add Water, and Pretty Ugly People. Also in 2007, McCarthy starred as Dena Stevens on the ABC sitcom Samantha Who?. McCarthy played Samantha's socially awkward childhood best friend, whom Samantha hasn't seen since seventh grade. When Samantha wakes from her coma, Dena convinces Samantha that they have always been best friends. While Andrea eventually forces her to reveal the truth, Samantha still remains friends with Dena. She guest starred in Rita Rocks and on Private Practice. In 2010, McCarthy played supporting roles in films The Back-Up Plan and Life as We Know It.

2011–present: Mike and Molly, Bridesmaids and success

McCarthy at the 84th Academy Awards in 2012

On September 20, 2010, McCarthy was cast in a leading role on the CBS sitcom Mike & Molly. In 2011, McCarthy had a breakout performance in the comedy movie Bridesmaids alongside Kristen Wiig, Maya Rudolph, Rose Byrne, Wendi McLendon-Covey and Ellie Kemper. McCarthy received an Academy Award nomination for her performance. In fall 2011, after achieving fame from Bridesmaids, she received her first Emmy Award for Outstanding Lead Actress in a Comedy Series for her role on Mike & Molly. In June 2011, she hosted the Women in Film Crystal + Lucy Awards. McCarthy later had supporting roles in This Is 40 (2012), the semi-sequel to Judd Apatow's film Knocked Up, and The Hangover Part III (2013). She was invited to join the Academy of Motion Picture Arts and Sciences in June 2012 along with 175 others. McCarthy hosted Saturday Night Live on October 1, 2011, on April 6, 2013, on February 1, 2014, on February 13, 2016, and on May 12, 2017. She was nominated five times for a Primetime Emmy Award for Outstanding Guest Actress in a Comedy Series for her appearances on the television show from 2011–2017, winning in 2017.

In 2013, McCarthy co-starred in the crime comedy Identity Thief with Jason Bateman. Identity Thief opened at #1 at the box office, and grossed $174 million worldwide despite negative reviews. In his negative review of the film, film critic Rex Reed controversially made several references to McCarthy's weight, referring to her as "obese" and using pejorative terms to refer to her weight. Reed's comments attracted wide criticism from various film critics and the industry at large. Film critic Richard Roeper said, "This just smacks of mean-spirited name-calling in lieu of genuine criticism." In a column for The Huffington Post, Candy Spelling likened Reed's review to bullying.

Later in 2013, McCarthy co-starred with Sandra Bullock in the buddy cop comedy The Heat. The film was released in the United States and Canada on June 28, 2013 to both critical and commercial success. With McCarthy being called "box office gold, The Heat grossed $229 million worldwide. McCarthy co-wrote the script for the movie Tammy, which was released on July 2, 2014. McCarthy's character loses her job and her car, and then learns that her husband has been unfaithful. To get away, she is forced to rely on her alcoholic grandmother (Susan Sarandon) for transportation as they embark on a journey of self-discovery.

McCarthy produced a CBS pilot which starred her husband, Ben Falcone. McCarthy played the female lead, opposite Bill Murray, in the 2014 comedy film St. Vincent, directed and written by Theodore Melfi. On November 19, 2014, it was announced that McCarthy would portray fairy heroine Tinker Bell in the untitled comedy-adventure directed by Shawn Levy. She would also produce the film. In addition, McCarthy was the lead in frequent collaborator Paul Feig's spy comedy Spy (2015), a role that earned McCarthy her first Golden Globe Award nomination.

In May 2015, McCarthy received a star on the Hollywood Walk of Fame. In August 2015, Forbes ranked her as the third highest-paid actress of 2015, with earnings of $23 million.

In 2016, McCarthy starred in The Boss, a comedy film based on a character which McCarthy had created in the Los Angeles Groundlings – a wealthy businesswoman "who goes to jail for insider trading, and struggles to reinvent herself as America’s new sweetheart when she's released". Also that year, she played an author and scientist in the all-female reboot of Ghostbusters, directed by Paul Feig.

On May 31, 2016, McCarthy was cast as celebrity biographer Lee Israel in the dark comedy-drama film Can You Ever Forgive Me? directed by Marielle Heller. She replaced Julianne Moore who exited the film.

On February 4 and 11, 2017 she made surprise appearances on Saturday Night Live portraying White House Press Secretary Sean Spicer. She returned to the show to portray Spicer on April 16 and May 13, 2017 (also hosting the latter).

McCarthy appeared in a Super Bowl LI ad for Kia Motors, promoting the Kia Niro. McCarthy played a wannabe environmentalist, who has a series of mishaps befall her such as being capsized by a whale, being charged by a rhino, and falling down a crevasse. The commercial featured the song "Holding Out for a Hero".

Personal life

McCarthy married her longtime boyfriend, Ben Falcone, an actor and alumnus of The Groundlings, on October 8, 2005. The couple have two daughters, Vivian (born May 2007) and Georgette "Georgie" (born March 2010). McCarthy's pregnancy with Vivian was written into the last season of Gilmore Girls. Their daughter Vivian played the younger version of her mother's character in the 2016 movie The Boss.

Falcone often makes cameo appearances in movies and television shows starring McCarthy, such as a third-season episode of Gilmore Girls, Bridesmaids, The Heat, Tammy, Identity Thief, Spy, and The Boss.

Since the start of the Mike & Molly series, McCarthy has lost an estimated 75 lb (35 kg). She credits the weight loss to a high-protein, low-carbohydrate diet, regular exercise, and a "super-boring life" that includes a 7:30 p.m. bedtime.

McCarthy is the cousin of actress, model, and television host Jenny McCarthy.

On The Day Productions

In 2013, McCarthy founded the production company On the Day with her husband Ben Falcone. Tammy was the new company's first project. The film cost $20 million, quite a low budget, and McCarthy, who can command close to $10 million a role, took a smaller upfront salary in exchange for a larger-than-normal cut of the film's proceeds, according to people familiar with the deal.

Production credits

Film

  • Tammy (2014; co-production with Warner Bros. Pictures, New Line Cinema and Gary Sanchez Productions)
  • The Boss (2016; co-production with Universal Pictures and Gary Sanchez Productions)
  • Life of the Party (2018; co-production with Warner Bros. Pictures and New Line Cinema)
  • The Happytime Murders (2018; co-production with STX Entertainment and Henson Alternative)
  • Super Intelligence (2019; co-production with Warner Bros. Pictures and New Line Cinema)
  • Margie Claus (2019; co-production with Warner Bros. Pictures and New Line Cinema)
  • Untitled Tinker Bell Project (TBA; co-production with 20th Century Fox and 21 Laps Entertainment)
  • Untitled Female Boston Cops Project (TBA; co-production with Warner Bros. Pictures and New Line Cinema)
  • Cousin Irv From Mars (TBA; co-production with Universal Pictures)
  • Just Do It (TBA; co-production with 20th Century Fox)
  • Untitled Stanley Cup Project (TBA; co-production with Paramount Pictures)

Television

  • Nobodies (2017–18; co-production with Jax Media)

Fashion line

McCarthy, who studied Textiles at Southern Illinois University, originally was interested in a career in fashion before she pursued a career in acting. When she first moved to New York City, it was to attend the Fashion Institute of Technology. One of her closest friends is shoe designer Brian Atwood. McCarthy also spent time working as the costumer for a dance company.

Following her films, she teamed up with Sunrise Brands to manufacture her first clothing collection, Melissa McCarthy Seven7, for plus-size women. The line will include clothes up to size 28. McCarthy states that "People don't stop at size 12. I feel like there's a big thing missing where you can't dress to your mood above a certain number. Malls segregate plus-size" clothes stores and hide these stores away from other sections of the mall. Her fashion line, Seven7, debuted in August 2015 on the Home Shopping Network, with plans for her designs to be sold in major retailers.

Filmography

Film

Year Film Role Notes
1998 God Margaret Short film
1999 Go Sandra
2000 Charlie's Angels Doris
Drowning Mona Shirley
Auto Motives Tonnie Short film
Disney's The Kid Sky King Waitress
2002 Pumpkin Cici Pinkus
The Third Wheel Marilyn
White Oleander Paramedic
2003 The Life of David Gale Nico the Goth Girl
Chicken Party Tot Wagner
Charlie's Angels: Full Throttle Woman at Crime Scene credit only
2007 Cook-Off! Amber Strang
The Nines Margaret / Melissa / Mary
The Captain Fran Short film
2008 Just Add Water Selma
Pretty Ugly People Becky
2010 The Back-Up Plan Carol
Life as We Know It DeeDee
2011 Bridesmaids Megan Price
2012 This Is 40 Catherine
2013 Identity Thief Diana/Dawn Budgie
The Hangover Part III Cassy
The Heat Detective Shannon Mullins
2014 Tammy Tammy Banks Also screenwriter and producer
St. Vincent Maggie Bronstein
2015 Spy Susan Cooper
2016 The Boss Michelle Darnell Also screenwriter and producer
Central Intelligence Darla McGuckian Cameo
Ghostbusters Dr. Abigail "Abby" Yates
2018 Life of the Party Deanna Miles Also screenwriter and producer
The Happytime Murders Detective Connie Edwards Also producer
Can You Ever Forgive Me? Leonore "Lee" Israel
2019 The Kitchen Kathy Post-production
Super Intelligence Carol Peters Post-production; also producer

Television

Year Title Role Notes
1997 Jenny Melissa Episode: "1.5"
2000 D.C. Molly 2 episodes
2000–2007 Gilmore Girls Sookie St. James 122 episodes, main cast
2002–2005 Kim Possible DNAmy (voice) 3 episodes
2004 Curb Your Enthusiasm Saleswoman Episode: "The Surrogate"
2007–2009 Samantha Who? Dena 35 episodes
2009 Rita Rocks Mindy Boone Episode: "Why Can't We Be Friends?"
2010 Private Practice Lynn McDonald Episode: "Best Laid Plans"
2010–2016 Mike & Molly Molly Flynn 127 episodes
2011–2017 Saturday Night Live Herself (host) 5 episodes
2012 The Penguins of Madagascar Shelley (voice) Episode: "Hair Apparent/Love Takes Flightless"
2016 Gilmore Girls: A Year in the Life Sookie St. James Episode: "Fall"
2017 Saturday Night Live Sean Spicer 3 episodes
2017–2018 Nobodies Herself 7 episodes; also executive producer

Awards and nominations

The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Melissa McCarthy?
To suggest a correction, or to flag this profile for review, click:
References
References
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-downpandoragplaydeezerihearttuneinpandoragplaydeezerihearttuneinitunes