Quantcast
MOH
comment(s)
49 views this wk.
MOH

Maximilian of Hesse-Kassel

German pricne
The basics
About
Date of birth Marburg
Date of death May 08, 1753 Kassel
Family
Mother: Maria Amalia of Courland
Father: Charles I Landgrave of Hesse-Kassel
Spouse: Friederike Charlotte of Hesse-Darmstadt
Brother(s): George Charles of Hesse-Kassel William VIII Landgrave of Hesse-Kassel Frederick I of Sweden
Children: Princess Ulrike Friederike Wilhelmine of Hesse-Kassel Princess Wilhelmina of Hesse-Kassel Caroline van Hessen-Kassel Princess Christine Charlotte of Hesse-Kassel
Authority VIAF id
The details
Biography

Maximilian of Hesse-Kassel (28 May 1689, Marburg – 8 May 1753, Kassel) was a prince of Hesse-Kassel and a Generalfeldzeugmeister, Generalfeldmarschall and finally Reichsgeneralfeldmarschall in the army of the Holy Roman Empire.

Life

Maximilian was the ninth son of Charles I, Landgrave of Hesse-Kassel (1654–1730), and his wife, Marie Amalia (1653–1711), daughter of Jacob Kettler, Duke of Kurland.

In 1720 he married Friederike Charlotte of Hesse-Darmstadt (1698–1777), a daughter of Ernest Louis, Landgrave of Hesse-Darmstadt. The marriage was meant to symbolise the new harmony between Hesse-Kassel and Hesse-Darmstadt, but was complicated by the two families' annoyance over his lavish lifestyle. In 1723 his father gave Maximilian the domain of Jesberg, which included the Richerode estate. In Jesberg, Maximilian built the baroque Schloss Jesberg and in nearby woodland built the 'Prinzessingarten' for his daughters. He was a passionate musician, maintaining a separate court-orchestra of his own, but this plunged him into debt.

Marriage and issue

He had eight children:

  1. Prince Karl of Hesse-Kassel (30 September 1721 in Kassel - 23 November 1722 in Kassel)
  2. Princess Ulrike Friederike Wilhelmine of Hesse-Kassel (31 October 1722 in Kassel - 28 February 1787 in Eutin); married in 1752 Frederick August I, Duke of Oldenburg.
  3. Princess Christine Charlotte of Hesse-Kassel (11 February 1725 in Kassel - 4 June 1782 in Kassel), from 17 April 1765 canoness of Herford Abbey, from 12 July 1766 coadjutor abbess of Herford.
  4. Princess Maria of Hesse-Kassel (25 February 1726 in Kassel - 14 March 1727 in Kassel)
  5. Princess Wilhelmina of Hesse-Kassel (1726–1808); married in 1752 Prince Henry of Prussia, younger brother of Frederick the Great.
  6. A stillborn child (born and died October 1729 in Kassel)
  7. Princess Elisabetha Sophia Louisa of Hesse-Kassel (10 November 1730 in Kassel - 4 February 1731 in Kassel)
  8. Princess Caroline Wilhelmina Sophia of Hesse-Kassel (10 May 1732 in Kassel - 22 May 1759 in Zerbst); married in 1753 Frederick Augustus, Prince of Anhalt-Zerbst, younger brother of Catherine the Great.

The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Maximilian of Hesse-Kassel?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-downpandoragplaydeezerihearttuneinpandoragplaydeezerihearttuneinitunes