Suggest a change
26 views this week

Matthew Kantakouzenos

Byzantine emperor
The basics
Date of birth
Date of death Jun 23, 1383 Mystras, Sparti, Sparta, Peloponnese Region
Brother(s): Manuel Kantakouzenos
Sister(s): Helena Kantakouzene
Mother: Irene Asanina
Spouse: Irene Palaiologina (Byzantine empress)
Children: Demetrios I Kantakouzenos Helena Asanina Kantakouzene John Kantakouzenos (despot)
Father: John VI Kantakouzenos
Authority VIAF id
The details

Matthew Asen Kantakouzenos or Cantacuzenus (Greek: Ματθαίος Ασάνης Καντακουζηνός, Matthaios Asanēs Kantakouzēnos, Bulgarian: Матей Асен Кантакузин, "Matey Asen Kantakuzin" c. 1325 – 15 June 1383) was Byzantine Emperor from 1353 to 1357.


Matthew Asanes Kantakouzenos was the son of Emperor John VI Kantakouzenos and Irene Asanina. In return for the support he gave to his father during his struggle with John V Palaiologos, he was given part of Thrace as an appanage in 1347, and was proclaimed joint emperor in 1353, when open civil war broke out again with John V.

From his Thracian domain, centred on Gratzianous, he led several wars against the Serbs. An attack, which he prepared in 1350, was frustrated by the defection of his Turkish auxiliaries. However, with five thousand Turks he tried to re-establish his former appanage along the Serbian-Byzantine border by attacking this region but failed to take Serres and soon was defeated in battle in late 1356 or early 1357 by a Serb army under Vojvoda Vojihna, the holder of Drama, a major fortress in the vicinity. The Serbs captured Matthew with the intention of releasing him when he had raised the large ransom they demanded. However John V, who had rapidly moved in to occupy Matthew's lands, offered Vojihna an even larger sum to turn Matthew over to him.

After imprisoning Matthew first on Tenedos, then on Lesbos under the watchful eye of Francesco I Gattilusio, John forced him to renounce the imperial title, John then released him to go to the Morea, where he joined his brother Manuel, who was ruling there (1361). After his brother's death in 1380, Matthew Asanes Kantakouzenos governed the Morea until the appointment of the new governor Theodore I Palaiologos, in 1381, and his arrival in 1382. Before full transition of power in the Morea, from the Kantakouzenos family to that of Palaiologos, Matthew resigned his power in the Morea to his son Demetrios I Kantakouzenos.


By his wife Irene Palaiologina, whom he married in Thessalonika early in 1341, Matthew Asanes Kantakouzenos had five known children:

  1. John Kantakouzenos, despotēs
  2. Demetrios Kantakouzenos, sebastokratōr
  3. Theodora Kantakouzene
  4. Helena Kantakouzene, who married Louis Fadrique, Count of Salona
  5. Maria Kantakouzene, who married John Laskaris Kalopheros
The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Matthew Kantakouzenos?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-down pandoragplay