260 views this wk.

Leslie Barnett

British biologist
The basics
Occupation Biologist Chemist
Country United Kingdom
AKA Margaret Leslie Collard
Date of birth London, Greater London, London, England
Date of death Feb 10, 2002
The details

Leslie Barnett (born 12 October 1920 in London, United Kingdom as Margaret Leslie Collard – died 10 February 2002) was a British biologist who worked with Francis Crick, Sydney Brenner, and Richard J. Watts-Tobin to genetically demonstrate the triplet nature of the code of protein translation through the Crick, Brenner, Barnett, Watts-Tobin et al. experiment of 1961, which discovered frameshift mutations; this insight provided early elucidation of the nature of the genetic code.

In her professional life, Barnett was a microbiologist who joined the Laboratory of Molecular Biology in Cambridge, where she worked as an assistant mainly with Crick and later Brenner, with whom she remained for many years until he left and she retired. During this long period Leslie Barnett was involved in a number of the important advances made in molecular biology and genetics; she witnessed the many technological and scientific advances made during the last century, some very important ones which she herself had contributed to.


Early career

At the beginning of the war Leslie had started training in the Institute of Agriculture in Essex but in 1939 took a job in Felixstowe as an apprentice at a local dairy, milk testing, and later with United Dairies in London. After evacuation to Banbury and several further jobs she returned to London where she met and married James in 1945. He insisted that she took up the offer of a place at Reading University and she remembered these as some of the happiest days of her life, studying for her BSc in dairying. Leslie continued to be fond of James despite their divorce when the children were quite young. She was the mother of Penny and Marion Barnett.

Barnett came to work as a technician in the MRC Unit shortly before the move from the Cavendish Laboratory to "The Hut" in Cambridge. Her role was to help with the computing for the crystallographers. On the arrival of Sydney Brenner, however, help was needed to set up the phage research and then to prepare for the arrival of Seymour Benzer and other American visitors that autumn. Leslie worked with Vernon Ingram in determining the GLU to VAL amino acid change in the beta chain of Hb responsible for the sickle cell phenotype. This was the first molecular disease characterized. Barnett showed her versatility when she transferred to Brenner's programme and made a major contribution to the laboratory work, becoming a co-author of their two major papers on the results. In 1966 she was appointed Senior Tutor at the new graduate college, Clare Hall, Cambridge. She proved very popular in this work.

On Brenner's retirement in 1986, Barnett left the LMB to work for him in the new MRC Molecular Genetics Unit in Addenbrooke's Hospital. She trained the late Francis Crick in experimental work on phage and assisted him.

Barnett also helped set up Sydney Brenner's laboratory in Singapore, many years later.

Late career

Barnett was amongst the early Fellows elected to join Clare Hall, the newly founded graduate college. In 1972, she became a tutor for graduate students; in 1975, she took over the leading role of Senior Tutor, which she held until her retirement in 1985. She was remembered by hundreds of students of various nationalities, ages and subjects for her steadfast care, wisdom in solving their problems, and motherly love.."

Leslie Barnett played a leading role in college affairs, particularly in the organising of social events and parties and will be remembered with great affection by her colleagues and other friends associated with the college. As a token of her contribution to the college the Governing Body has named a student residence the Leslie Barnett House and a bronze head [by the late Lois Tilbrook] represents another tribute to her on the site. On retirement she was elected to an Emeritus Fellowship and attended regularly until her last illness.."

Death and tributes

Eric Miller who was a visiting scientist at the Molecular Biology Laboratory in 1986-87, wrote “Leslie Barnett should be recognised for her immense scientific contributions to the field of gene structure and function. Professionally, to which I am sure Francis Crick and Sydney Brenner will attest, many of the seminal discoveries in molecular biology would not have occurred without the careful hand, watchful eye and steadfast focus that Leslie brought to the bench and experiments." Francis Crick said "Alex Rich and I engaged Leslie in 1955 to do some x-ray calculations for us, since in those days electronic computers were still very primitive. After we discovered that Leslie had biological qualifications she did various types of experimental work. Among other things she worked with us on the phase-shift mutants of phage T4. She was invaluable, as she was always such a careful and meticulous experimentalist."

Scientific Papers to which Leslie Barnett contributed

  • Brenner, S., Benzer, S., and Barnett, L. 1958. "Distribution of proflavin-induced mutations in the genetic fine structure", Nature 182: 983-5.
  • Brenner, S. and Barnett, L. 1959 "Genetic and chemical studies on the head protein of bacteriophages T2 and T4', in Structure and Function of Genetic Elements. Report of Symposium Held June 1–3, 1959. Brookhaven Symposia 12 (Upton, NY: Brookhaven National Laboratory).
  • Brenner, S., Barnett, L., Crick, F.H.C. and Orgel, A. 1961 "The theory of mutangensis", The Journal of Molecular Biology 3: 121-4.
  • Crick, F.H.C., Barnett, L., Brenner, S. and Watts-Tobin, R.J. 1961. "General nature of the genetic code for proteins", Nature 192: 1227-32.


In 1978 at Clare Hall a second neighbouring house in Cambridge, now called Leslie Barnett House, was obtained for graduate student accommodation; it was named after the popular Senior Tutor.

Books containing references to Leslie Barnett

  • Sydney Brenner; 'My Life in Science', BioMed Central 2001, 199pp ISBN 0-9540278-0-9
  • Soraya De Chadarevian; Designs For Life: Molecular Biology After World War II, CUP 2002, 444 pp; ISBN 0-521-57078-6
  • Francis Crick; What Mad Pursuit: A Personal View of Scientific Discovery (Basic Books reprint edition, 1990) ISBN 0-465-09138-5
  • Georgina Ferry; 'Max Perutz and the Secret of Life', (Chatto & Windus 2007) 352pp, ISBN 978-0-7011-7695-2. For uncaptionned picture.
  • John Finch; 'A Nobel Fellow On Every Floor', Medical Research Council 2008, 381 pp, ISBN 978-1-84046-940-0; this book is all about the MRC Laboratory of Molecular Biology, Cambridge.
  • Errol Friedberg, "Sydney Brenner: A Biography" pub. CSHL Press October 2010, ISBN 0-87969-947-7.
  • Horace Freeland Judson, "The Eighth Day of Creation. Makers of the Revolution in Biology"; Penguin Books 1995, first published by Jonathan Cape, 1977; ISBN 0-14-017800-7.
  • Robert Olby; "Francis Crick: Hunter of Life's Secrets", Cold Spring Harbor Laboratory Press,ISBN 978-0-87969-798-3, published on 25 August 2009.
  • Max Perutz; What a Time I Am Having: Selected Letters, CSHL Press 2008, 506pp ISBN 978-0-87969-864-5. For captioned picture.
  • Matt Ridley; Francis Crick: Discoverer of the Genetic Code (Eminent Lives) first published in June 2006 in the US and then in the UK September 2006, by HarperCollins Publishers; 192 pp, ISBN 0-06-082333-X; in paperback, by Atlas Books (with index), ISBN 978-0-00-721331-3.
The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Leslie Barnett?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-down pandoragplay