Quantcast
JC
comment(s)
80 views this wk.
JC

John Casimir, Count Palatine of Kleeburg

Father of King Charles X of Sweden
The basics
About
Date of birth Zweibrücken
Date of death Jun 18, 1652 Stegeborg Castle
Family
Mother: Magdalene of Jülich-Cleves-Berg
Father: John I Count Palatine of Zweibrücken
Spouse: Catherine of Sweden Countess Palatine of Kleeburg
Brother(s): Frederick Casimir Count Palatine of Zweibrücken-Landsberg John II Count Palatine of Zweibrücken
Children: Charles X Gustav of Sweden Countess Palatine Maria Eufrosyne of Zweibrücken Christina Magdalena of the Palatinate-Zweibrücken Countess Palatine Eleonora Catherine of Zweibrücken Adolph John I Count Palatine of Kleeburg
Authority Library of congress id VIAF id
The details
Biography

John Casimir, Count Palatine of Zweibrücken-Kleeburg (20 April 1589, Zweibrücken – 18 June 1652, Stegeborg Castle) was the son of John I, Count Palatine of Zweibrücken and his wife, Duchess Magdalene of Jülich-Cleves-Berg and was the founder of a branch of Wittelsbach Counts Palatine often called the Swedish line, because it gave rise to three subsequent kings of Sweden, but more commonly known as the Kleeburg (or Cleebourg) line.
In 1591 his father stipulated that, as the youngest son, John Casimir would receive as appanage the countship of Neukastell in the Palatinate. Upon their father's death in 1611, however, the eldest son, John II, Count Palatine of Zweibrucken, instead signed a compromise with John Casimir whereby the latter received only the castle at Neukastell coupled with an annuity of 3000 florins from the countship's revenues (similarly, John Casimir's elder brother, Frederick Casimir, received the castle at Landsberg with a small surrounding domain, instead of the entire Landsberg appanage bequeathed to him paternally).
On 11 June 1615, Casimir married his second cousin Catherine of Sweden, and their son eventually became King Charles X of Sweden.

Family

Five of his children with Catherine survived infancy:

  • Christina Magdalena (1616–1662); married Frederick VI, Margrave of Baden-Durlach. King Adolf Frederick of Sweden was her great-grandson.
  • King Charles X Gustav of Sweden (1622–1660).
  • Maria Eufrosyne (1625–1687); married Count Magnus Gabriel De la Gardie.
  • Eleonora Catherine (1626–1692); married Frederick, Landgrave of Hesse-Eschwege.
  • Adolf John (1629–1689).

Ancestors

The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on John Casimir, Count Palatine of Kleeburg?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-downpandoragplaydeezerihearttuneinpandoragplaydeezerihearttuneinitunes