240 views this week
Donnie Wahlberg

Donnie Wahlberg

American actor
The basics
Occupation Singer Actor Musician Screenwriter Television actor
Country United States of America
Date of birth Boston, Suffolk County, Massachusetts, U.S.A.
Spouse: Jenny McCarthy
Brother(s): Robert Wahlberg Mark Wahlberg
Height: 1.778 m
Authority VIAF id NNDB id Library of congress id Musicbrainz id Discogs id IMDB id All Movie id ISNI id
The details

Donald Edmond "Donnie" Wahlberg Jr. (born August 17, 1969) is an American singer-songwriter, actor, record producer, and film producer. He is a founding member of the boy band New Kids on the Block. Outside of music, he has had roles in the Saw films, The Sixth Sense, Dreamcatcher, and Righteous Kill, also appearing in the World War II miniseries Band of Brothers. From 2002 to 2003, he starred in the crime drama Boomtown. He has been starring in the drama series Blue Bloods with Tom Selleck and Bridget Moynahan since 2010, and since 2014 is an executive producer of the TNT reality television show Boston's Finest. He was nominated for Choice Scream at the 2008 Teen Choice Awards for his work in the Saw films.

Early life

Wahlberg was born in the Dorchester neighborhood of Boston. He is the eighth of nine children, with older siblings, Arthur, Jim, Paul, Robert, Tracey, Michelle, and Debbie (died in 2003), and younger brother, Mark, who began his entertainment career in the former rap group Marky Mark and the Funky Bunch. He also has three half-siblings from his father's first marriage: Donna, Scott, and Buddy. His mother, Alma Elaine (née Donnelly), was a bank clerk and nurse's aide, and his father, Donald Edmond Wahlberg, Sr. (May 8, 1930 – February 14, 2008), was a teamster who worked as a delivery driver; they divorced in 1982. His father was of Swedish and Irish descent, and his mother is of Irish, English, and French-Canadian ancestry. Maternally, he is distantly related to author Nathaniel Hawthorne.


New Kids on the Block

Wahlberg in 1990

As a recording artist, Wahlberg is known as an original member of the boy band New Kids on the Block.

Acting career

Wahlberg's first film acting role was in the 1996 film Bullet with Mickey Rourke and Tupac Shakur. Also in 1996, he appeared as a kidnapper in Ransom with Mel Gibson. He went back to his home town for a starring role in the South Boston-based film Southie. Wahlberg received attention for his role in the 1999 film The Sixth Sense, playing the patient of Bruce Willis's character in the opening sequence.

In 2001, Wahlberg co-starred as Second Lieutenant C. Carwood Lipton in the television miniseries Band of Brothers. He also starred in the 2002–2003 NBC drama series Boomtown as Joel Stevens, a Los Angeles police detective. Graham Yost, executive producer and writer of Boomtown, had worked with him in Band of Brothers and was so impressed by his performance that he wrote the role of Joel Stevens specifically for him.

2003 was the year that Wahlberg starred alongside Timothy Olyphant, Jason Lee, and his Band of Brothers co-star Damian Lewis as the mentally challenged Duddits in William Goldman and Lawrence Kasdan's adaptation of the Stephen King alien-invasion thriller, Dreamcatcher. In 2005, he starred as Detective Eric Matthews in the second installment of the Saw series. He reprised the role in Saw III in 2006 and Saw IV in 2007, also appearing in Saw V in 2008 via archive footage from the previous films.

In 2006, Wahlberg also played Lieutenant Commander Burton in the military/boxing drama Annapolis. In September 2006, he played the lead role in the short-lived television drama Runaway on The CW. The show was cancelled in October 2006 due to poor ratings. In 2007, he starred in the television film Kings of South Beach on A&E. Also in 2007, he starred on the TV series The Kill Point.

In 2008, Wahlberg appeared in Righteous Kill. He also co-starred in What Doesn't Kill You. He also appeared in the 2011 comedy Zookeeper.

Wahlberg stars as 1st Grade Detective Danny Reagan on CBS's Blue Bloods, a police drama set in New York City.

As of 2011, Wahlberg is the host of an internet radio show on Friday nights at 8 pm PST called "DDUB's R&B Back Rub" on Cherry Tree Radio.

Personal life

Wahlberg married Kim Fey on August 20, 1999. They filed for divorce on August 13, 2008, citing "irreconcilable differences". They have two sons, Xavier Alexander Wahlberg (born March 4, 1993) and Elijah Hendrix Wahlberg (born August 20, 2001). In July 2013, it was reported by UsWeekly that he was dating actress and comedian Jenny McCarthy after meeting on Watch What Happens Live in March. They announced their engagement on The View on April 16, 2014. They wed on August 31, 2014, at the Hotel Baker in St. Charles, Illinois.

Wahlberg is a passionate fan of the Boston Celtics and has been seen attending many of their games. He narrated a documentary called "The Association: Boston Celtics" about the team's 2010–11 season, which aired on ESPN between 2010 and 2011. He also owns a restaurant in Boston named Wahlburgers with brothers Paul (the restaurant's head chef) and Mark.

In February 2016, Wahlberg endorsed Marco Rubio for President of the United States.


New Kids on the Block albums

  • New Kids on the Block (1986)
  • Hangin' Tough (1988)
  • Step by Step (1990)
  • Face the Music (1994)
  • The Block (2008)
  • 10 (2013)



Year Title Role Notes
1996 Bullet Shelby "Big Balls" Horne
Ransom Cubby Barnes
Black Circle Boys Greggo
1998 Body Count Booker
Butter Rick Damon
Southie Danny Quinn
1999 The Sixth Sense Vincent Grey
2000 Bullfighter Chollo
Diamond Men Bobby Walker
2002 Triggermen Hitman Terry Mulloy
2003 Dreamcatcher Douglas "Duddits" Cavell
2005 Saw II Detective Eric Matthews Nominated—Teen Choice Award for Choice Movie Scream
Marilyn Hotchkiss' Ballroom Dancing & Charm School Randall Ipswitch
2006 Annapolis Burton
Saw III Detective Eric Matthews
2007 Dead Silence Detective Jim Lipton
Saw IV Detective Eric Matthews
2008 Saw V Detective Eric Matthews
Righteous Kill Detective Ted Reily
What Doesn't Kill You Detective Moran
2011 Zookeeper Shane
Cast of TV series Blue Bloods at the 2010 Summer Session of the Television Critics Association.


Year Title Role Notes
1998 The Taking of Pelham One Two Three Mr. Grey Movie
1999 Purgatory Deputy Glen/Billy the Kid Movie
2000 The Practice Patrick Rooney Episode: "Settling"
2001 UC: Undercover Bobby Episode: "City on Fire"
Band of Brothers Carwood Lipton 10 episodes
Big Apple Chris Scott 7 episodes
2002–2003 Boomtown Detective Joel Stevens 24 episodes
2005 N.Y.-70 Det. Mike Ryan Movie
2006–2008 Runaway Paul Rader 10 episodes
2006 The Path to 9/11 Detective Kirk 2 episodes
2007 The Kill Point Detective Horst Cali 8 episodes
Kings of South Beach Detective Andy Movie
2009 Bunker Hill Detective Mike Moriarty Movie
2010 In Plain Sight Jimmy McCabe / Jimmy Porter Episode: "Father Goes West"
Rizzoli & Isles Lt. Joey Grant 2 episodes
2010–present Blue Bloods Detective Daniel Reagan Main role
Nominated – People's Choice Award for Favorite TV Crime Drama Actor (2017)
2013 Boston's Finest Narrator 8 episodes
2014–present Wahlburgers Himself Reality show
2015–present Donnie Loves Jenny Himself Reality show
2016 Fuller House Himself Guest appearance

Video games

Year Title Voice role
2008 Turok Shepherd
The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Donnie Wahlberg?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-down pandoragplay