Quantcast
CD
comment(s)
148 views this wk.
CD

Colleen Doran

American writer/artist, film conceptual artist, and cartoonist
The basics
About
Occupation Screenwriter
Country United States of America
Date of birth
Authority Library of congress id ISNI id IMDB id VIAF id
The details
Biography

Colleen Doran (born July 24, 1964) is an American writer/artist and cartoonist. She illustrated hundreds of comics, graphic novels, books and magazines, including the autobiographical graphic novel of Marvel Comics editor and writer Stan Lee entitled Amazing Fantastic Incredible Stan Lee, which became a "New York Times" bestseller. She adapted and did the art for the short story "Troll Bridge" by Neil Gaiman, which also became a "New York Times" bestseller. Her books have received Eisner, Harvey, and International Horror Guild Awards.

She illustrated the works of Neil Gaiman, Alan Moore, Warren Ellis, Joe R. Lansdale, Anne Rice, J. Michael Straczynski, Peter David and Tori Amos.

Notable credits include: The Sandman, Wonder Woman, Legion of Superheroes, Teen Titans, The Vampire Diaries comics, Walt Disney's Beauty and the Beast, and her space opera series, A Distant Soil.

She was one of two people listed among the top 25 female comic creators of all-time in both the writer and artist categories, ranking #7 among artists and #21 among writers. Comics Alliance listed Doran as one of twelve women cartoonists deserving of lifetime achievement recognition.

Early work

At age five, Doran won an art contest sponsored by the Walt Disney Company. Doran created her comic book series, A Distant Soil, at age twelve.

Doran landed her first work for an advertising agency at age fifteen. She attended Christopher Newport University and the Art Institute of Pittsburgh and used her professional works for curriculum credit. Science fiction artist Frank Kelly Freas was her mentor, and she apprenticed with him in the early 1980s.

She broke into the comic book industry when still a teenager, scouted by Tom Long for his fanzine Graphic Showcase. Long hired Doran to draw a revival of the 1940s character Miss Fury. Underage Doran quit the assignment due to its adult content. She also contributed illustrations to the Hugo Award nominated fanzine Lan's Lantern.

A Distant Soil was published in fanzines as early as 1979, then scouted by The Donning Company Starblaze imprint before it was contracted by WaRP Graphics. Doran left the company after nine issues due to an acrimonious dispute with WaRP, which attempted to claim copyright and trademark on her work. The WaRP version of the story has never been reprinted despite its unusual all-pencil style, and Doran's ownership of the publishing rights.

Career

Doran discarded the 300 pages of work she did at Warp, and rewrote and redrew the entire A Distant Soil story from scratch, first with Donning, then as a self-publisher. A 1000 page long-form comics narrative, it has been published by Image Comics since 1996. It sold more than 700,000 copies in multiple printings. The production archives were destroyed by the printer, and an extensive restoration process brought the series back to publication in 2013.

Doran was scouted by Keith Giffen to work at DC Comics after he saw her work in the Legion of Superheroes fanzine Interlac. They went on to become frequent collaborators at DC on The Legion of Superheroes projects, Justice League 3001, and the series Reign of the Zodiac. Her art also appeared in Amethyst, Princess of Gemworld #12, multiple issues of Who's Who in the DC Universe and Who's Who in the Legion of Superheroes, Superman: Man of Steel Gallery, Christmas with the DC Superheroes, Captain Atom, Star Trek, and Hawkman Annual. She did art for several Teen Titans and Wonder Woman projects.

She illustrated portions of the "Dream Country" and "A Game of You" story arcs in Neil Gaiman's The Sandman series. The character Thessaly in Neil Gaiman's Sandman is based on Doran. Other Vertigo appearances include Shade, The Changing Man, Lucifer (DC Comics), Transmetropolitan and the original graphic novel Orbiter (comics) written by Warren Ellis.

Doran's premiere at Marvel Comics was in 1986, The Swords of the Swashbucklers #9 and 11, with issue 11 having the dubious distinction of being one of the books confiscated in the 1986 Friendly Franks "obscene" comics raid that precipitated the formation of the Comic Book Legal Defense Fund. Swords of the Swashbucklers was eventually excluded from the prosecution proceedings.

Doran worked on other projects at Marvel including The Guardians of the Galaxy Annual #3, The Silver Surfer, Marvel Fanfare, Excalibur #28, Captain America: Drug Wars, Amazing Spider-Man, Friendly Neighborhood Spider-Man, a Power Pack mini-series, Handbook of the Marvel Universe, Mutant X, X-Factor, Marvel Girl Comics, and X-Men Millennial Visions for which she wrote and drew an entry. She also worked in the Special Projects Department on promotional, educational, and greeting card art, sometimes working directly with Stan Lee.

At Marvel Comics' Epic division, she worked on Clive Barker's Nightbreed #21 and #22 as interior and cover artist, and Clive Barker's Hellraiser #5 and #14, as artist and colorist.

Doran was a web columnist for Wizard Magazine in the early 1990s, and illustrated Super Idol for Warren Ellis in 2001, an early webcomics format experiment at Artbomb.

Doran is featured in the films Ringers (a documentary about The Lord of the Rings fans), Scenes From the Small Press: Colleen Doran by Rich Henn, Sex, Lies and Superheroes, the documentary The Cartoonist about Bone creator Jeff Smith, and Captured Ghosts, a documentary about writer Warren Ellis. She was also featured in the Dec. 12, 2011 episode of "Stalked: Someone's Watching," a Discovery ID television series that profiles stalking incidents, focusing on interviews with victims.

Doran worked as a creator rights activist, as lobbyist in Washington DC, and served on the advocacy committee of the Graphic Artists Guild. Lecture venues include the Smithsonian Institution, The Singapore Writers Festival, the Comics Masterclass in Sydney, Australia, and the Maryland Institute College of Art. She spoke at CREATE: Protecting Creativity from the Ground Up at the Newseum in Washington DC, with Congresswoman Marsha Blackburn, Rick Carnes President of the Songwriters Guild of America, musician Suzanne Vega, and other artists and technology policy specialists.

Current work

Doran illustrated best-selling young adult novelist Barry Lyga's first graphic novel for Houghton Mifflin, Mangaman in 2011. It received a starred review at Kirkus Reviews, as well as awards at the New York Book Show and New England Book Builders of Boston, both granted to the design team.

Gone to Amerikay a graphic novel drawn by Doran and written by Derek McCulloch was released in 2012 from DC/Vertigo. It is a "multi-generational Irish saga." It was profiled in The Wall Street Journal, Boing Boing and Irish Echo. Gone to Amerikay themed cover art was featured in the St Patrick's Day edition of Irish Echo, which was then presented to President Obama by Deputy First Minister Martin McGuinness of Northern Ireland. Gone to Amerikay was chosen for inclusion in the 2013 Best American Comics.

Doran produced cover art for The Walking Dead #1 (2015, Image Comics), Red Sonja (Dynamite, 2014), Marvel's S.H.I.E.L.D. #4 (2015), and Squirrel Girl #7 (2016). For DC Comics, she wrote and drew stories for The Vampire Diaries (2014) comics based on the TV show, and art for Justice League 3001 #6, 9 and 10 (2015-2016). For IDW's Womanthology (2012), she contributed biographical essays about classic cartoonists Rose O'Neill and Ethel Hays.

In 2015, she illustrated the bestselling autobiography Amazing Fantastic Incredible Stan Lee co-written by Lee and Peter David.

With Alan Moore, she did the art for Big Nemo, a dystopian sequel to Winsor McCay's Little Nemo in Slumberland as an experimental webcomic created for the award-winning Electricomics app.

She did the art for an adaptation of Neil Gaiman's short story "Troll Bridge" as a graphic novel for Dark Horse released in October 2016. She also worked on issues of Faith and X-O Manowar for Valiant Comics. She was announced as an artist for the upcoming comic adaptation of Neil Gaiman's American Gods. The series Finality with Warren Ellis was announced with Colleen Doran as artist via Line Webtoon.

Exhibits

  • Four Color Images Gallery, New York, NY
  • Kunstlerhaus, Stuttgart, Germany
  • Porto, Portugal
  • Secession Gallery, Vienna, Austria
  • Gijon Cultural Center, Gijon, Spain
  • San Francisco Cartoon Art Museum, San Francisco, CA
  • Museum of Cartoon Art, Rye Brook, New York
  • Gallery Nucleus: 20 Years of Sandman 2008
  • Gallery Nucleus: A Handful of Dust, 25 Years of Sandman
  • Krannert Art Museum; Out of Sequence: Underrepresented Voices in American Comics
  • Laboratory of Art and Ideas at Belmar; Out of Sequence
The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on Colleen Doran?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-downpandoragplaydeezerihearttuneinpandoragplaydeezerihearttuneinitunes