Suggest a change
29 views this week

August Dickmann

male human
The basics
Date of birth Dinslaken, Wesel, Düsseldorf Government Region, North Rhine-Westphalia
Date of death Sep 15, 1939 Sachsenhausen concentration camp, Oranienburg, Oberhavel, Brandenburg
The details

August Dickmann (* à Dinslaken; † à Sachsenhausen) était un opposant au régime nazi, Témoin de Jéhovah. Il fut le premier objecteur de conscience à être exécuté en Allemagne pendant la Seconde Guerre mondiale.


Après sa scolarité obligatoire, August Dickmann travaille dans une scierie. Pendant l'année 1932, avec ses frères Heinrich et Fritz, August Dickmann commence une étude de la Bible avec les Témoins de Jéhovah. À la suite de cette étude, les trois frères débutent une œuvre de prosélytisme en Allemagne comme missionnaires. En 1933, les activités des Témoins de Jéhovah sont interdites en Allemagne, à la suite de la prise de pouvoir d'Adolf Hitler. Les trois frères continuent néanmoins leurs activités de prosélytisme. En 1935, Fritz Dickmann est interné à Esterwegen (camp de concentration) et en octobre 1936 August Dickmann est à son tour arrêté par la Gestapo et emprisonné. Après sa peine de prison, en octobre 1937, il est interné dans le camp de concentration de Sachsenhausen. Heinrich Dickmann sera aussi arrêté et il rejoint son frère August dans ce camp en mars 1939.

Le refus de servir


Le 1er septembre 1939 les armées allemandes envahissent la Pologne, c'est le début de la Deuxième Guerre mondiale. August Dickmann est encore emprisonné dans le camp de concentration de Sachsenhausen. En tant que citoyen allemand, il reçoit l'ordre de rejoindre la Wehrmacht, mais August Dickmann est Témoin de Jéhovah et donc objecteur de conscience. À la suite de son refus de servir, il est mis au secret.

Sous le régime nazi, tout homme refusant de servir dans l'armée était condamné à mort par pendaison ou fusillé. Le commandant du camp de Sachsenhausen, Hermann Baranowski, obtient de Heinrich Himmler la permission d'exécuter August Dickmann devant les centaines d'autres Témoins de Jéhovah emprisonnés dans le camp, dont son frère Heinrich, vraisemblablement pour briser leur moral.

Le 15 septembre 1939, August Dickmann est conduit devant le peloton d'exécution et passé par les armes. Le peloton était sous les ordres de Rudolf Höß, alors adjudant d'Hermann Baranowski. Selon certains témoignages, ce fut lui qui acheva August Dickmann d'un coup de pistolet dans la tête. Il avait 29 ans. Son frère, Heinrich Dickmann, a survécu à la guerre.

Réactions dans le monde

La nouvelle de l'exécution de August Dickmann fut donnée de manière répétée par la radio d'état allemande à partir du 16 septembre. Le communiqué officiel suivant fut aussi publié par plusieurs journaux allemands:

« Exécution de deux saboteurs de la Nation. Communiqué du chef des SS. Le chef des SS et chef de la police allemande communique : ...le 15 septembre 1939 pour refus d'accomplir ses devoirs de soldat, August Dickmann, né le 7 janvier 1910, de Dinslaken. Dickmann a déclaré qu'il est Témoin de Jéhovah, un fanatique adepte de la secte des Étudiants de la Bible. »

La mort de August Dickmann a eu en fort retentissement dans le monde car elle fut la première exécution d'un objecteur de conscience en Allemagne.

Le 17 septembre 1939, le New York Times publiait cette nouvelle :

« L'Allemagne exécute un objecteur de conscience. Berlin, 16 septembre. Le premier objecteur de conscience allemand de cette guerre, August Dickmann, 29 ans, de Dinslaken, accusé de "sabotage", a été fusillé. L'annonce de son exécution a été faite par Heinrich Himmler, chef de la police allemande, en ces termes : "il a été fusillé pour avoir refusé d'accomplir son devoir de soldat" au motif de conscience religieuse. Dickman avait affirmé être membre des Témoins de Jéhovah et du mouvement international de Rutherford. »

Une plaque commémorative en mémoire de August Dickmann a été inaugurée le 18 septembre 1999, à l'occasion du 60e anniversaire de son martyr.

Notes et références


  • Johannes Wrobel, Die öffentliche Hinrichtung des Zeugen Jehovas August Dickmann am 15. September 1939 im KZ Sachsenhausen, Manuscrit de l'exposé présenté lors de l'inauguration de la plaque commémorative dédiée à August Dickmann, 18 septembre 1999, Museum de Sachsenhausen (PDF)
  • Morsch Günter, Bohra Stephanie et alter, Wehrdienstverweigerung aus religiösen Motiven: August Dickmann, 15. September 1939, in Mord und Massenmord im Konzentrationslager Sachsenhausen 1936-1945. Eine Ausstellung der Gedenkstätte und des Museums Sachsenhausen, Stiftung Brandenburgische Gedenkstätten, Metropol, Berlin, 2005, pages 78–84. (ISBN 3-936411-93-X)
  • Jean Bezaut, Oranienbourg, 1933-1935, Sachsenhausen, 1936-1945 : étude, Maulévrier, France, Hérault, , 366 p. (ISBN 978-2-903-85171-2).

Liens internes

  • Témoins de Jéhovah sous le IIIe Reich

Liens externes

  • Portail de la Seconde Guerre mondiale Portail de la Seconde Guerre mondiale
  • Portail du nazisme Portail du nazisme
  • Portail des religions et croyances Portail des religions et croyances
  • Portail sur la paix Portail sur la paix
The contents of this page are sourced from a Wikipedia article. The contents are available under the CC BY-SA 4.0 license.
comment(s) so far
Leave a comment
Add a word
What's the good word on August Dickmann?
To suggest a correction, or to flag this profile for review, click:
align-centeralign-justifyalign-leftalign-rightcalendarclosedeletediscographydownloadfacebookvideogplusgridinfoinstagramlikelinklinkedinwhatsappmyspacenew-windowquoraquoteredditsearchsoundcloudspotifytumblrtwittervertical-ellipsisviewvinevkwebsiteyoutubebriefcaseeditmaillocationcardawardchildeducationfamilydeathradiotvcamerabibliographymoneytheaterbaseballbasketballfootballpoliticsarrow-right-longarrow-left-longbiographybusinessarrow-leftarrow-rightbodybuildingrunningswimmingtable-tennischesscommentsusernewscommentsresizelogoutstumbleuponchartwordlistarrow-uparrow-down pandoragplay